< ' u 'Op TheUnlversity of Memphis SCHEDULE OF CLASSES NOTICE Major Changes: • April Registration Expected for Continuing Students • Fees Due By August 1 • Pay Fees By Mail • Substantial Late Registration Penalty DETAILS BEGINNING PAGE 4 FALL '95 DlRECTORY^OF CLASSFS 7630"PUBLISHEDINwinter/springseries1995 ©1995AMERICANPASSAGEMEDIACORPORATION 101 EcOY\OtY\i<L$ ' simple. Call anybody, anywhere in the USA, anytime. It's And save 20%. With AI&T True USA Savings. Finally a long distance savings plan that doesn't a month ormore, andyou'll enjoy an automatic call for a prerequisite inAdvanced Calculus. We're 30%off! And you'll still save 10% during months talkingaboutAT&TTrueUSA" Savings. \bu simply when you spend at least $10. It's so simple-the can call anybody anywhere in the USA, anytime, more you talk, the more you can save. and save 20% offyourAT&T long distance calls* So when you're done signing up for classes, Guaranteed. give us a call and sign up forAT&TTrueUSA" Just call us, and then wheneveryou spend $25 Savings. And show the folks back home how a month on qualifying AT&T long distance calls, smart college is really making you. Call now, we'll subtract 20% offyourAT&Tbill.** Spend $75 i 800-true-usa: AIXT.YourTrueVoicer 'CertainexclusionsapplyAvailableinmostareas. AT&T 'SavingsoffAT&Tbasicresidentialrates. €> 1WSAIXT The Memphis University of 1995 SCHEDULE OF CLASSES all ENROLLMENT A FIVE STEP PROCESS - To enroll at The University of Memphis, students must complete the following steps: Step 1. Admission or Readmission 4 (forstudents not enrolled Spring 1995) Step 2. Academic Advising 5 Step 3. Registration - Course Selection 6 Step 4. Student Financial Aid 10 (if applicable) Step 5. Fee Payment 12 All steps must be completed in the proper sequence at the proper time to finalize the enrollment process. FALL 1995 THE UNIVERSITY OF MEMPHIS 1 AdvertisingincludedinthispublicationisinnowayendorsedbytheUniversity.TheadvertisingsubsidizesthepublicationofthisbookletandtheUniversityreceivesnootherrevenue Iromthissource. FALL 1995 CONTENTS I. SEMESTERCALENDAR 3 ID&TInstructionalDesign&Technology- ED404 68 ENROLLMENT INSE IndustrialSystemsEngineering -EN 104 68 II. ISDSManagementInformation Systems/ Admission 4 DecisionSciences-BO300 69 Advising 5 ITALItalian-DH375 70 Registration 6-9 JAPNJapanese-DH375 70 SFteuedePnatymFiennatncialAid 1102 JLLAOALTUINRLLaJanotugirnuna-aglDeiHssm&37-L5MiJter3a0t0ure-DH375 777022 III. EXAMINATION/TESTING SCHEDULES ,^±8 LDPSLeadership& PolicyStudies-PT 113 ... 72 IV. ACADEMIC POLICIES & PROCEDURES 20 LLIENAGDLLienagudiesrtsihcisp--DPHT317153 7723 V. TRIALSCHEDULE FORM MATH Mathematics-DH373 73 GuidetoReadingtheClassListings 26 MMEGCMHTMMeacnhaagniecmaelntEn-giBnOee2r0i2ng- EN312 7756 VI. CLASS LISTINGS-Alphabetical bySubjectAreaHeading MKEDMarketing Education-MN404 77 SeeMaponthe LastPageforBuildingCodesand Locations MKTG Marketing -BO302 77 AAAAAAACCCCCCCCCCCCBBBBDEEEEEIIHAIJLRNCUCPCLLSERUAHOMCDOCOVOIOUAEETTCSFSAEEEPRMNEUUOMMLBLNMCDSSHTPAYDDDRDOCYNMNuSPAMCBsrCBiCCEEAAACCiACtABEEiDAvEhCCCClilrlCnoucooaidcuneoeahocirooao-ileltrdcoumuscearneunnosmmmmmoJlmhiotncmmisdoEmnseescnimygryeporuasOumnsnsieisdinsyoeuenlntouenuegccCsepimoe-rmiottpmAl2taisinsh-tlclai-ogidcaoAil0iecesniiari-oc(cnmynlrT1i•cnnearrllcyngEEeaiDgsoyEagsneDCtdygaacnnlgdlSSHr--iehiAoHgnt---EPyu-&icc-ooPxsESlidiJdscEBMniiB3otnsonE-3Tu1oMyaOugCeeTrdO7I/gySeOc7nDt4cMrsnnaVFy5ecp3a5i-ih43it22ccEN2irhtS43emo1oi10c-Edee01Din0oiti0n0eo0l0u430ENne0l3onun0-7c-&o0cgadnoB-1ghaMDAli-1g6BEyt-r-eUH0y1BdPiJtOsE4E0-usuaoO&N33scD1nt-E2-/t7ah24TRD0iM2C-t34o33ec2iC0il0FEe2sc1o6Ao4ADre0ng-oa0y1Mb42-r4li03c•Mo344hS4lNDpo0-ge54Eye0cDL4hS/1H020r0n1g)Ctr 2222333333333344444444444455511744783799003889022568899923 TSSTMMMMMNNPPPPPRRRRRSSSSUUPHNOALEHLOPSPAH&EUHUENUUUUUDWIDICCFAELCYAEVYDHSERCHAHSSTNRLeVIENSAHCNDYSSBSDSRPPLEACGvKSPepUSSCTPSShPPENPRRRnMolNRUASMMoRSiaohpinphsheainuereuupocuuaotlefeehlgyyvaivytiscrpymscipssceacaaesviotsancsrsilsoeimiirtbidiretiansiliaehiiilcdecccyieasricr&eonclaesnoaaolinilsdaeneSpsldtdgh-glHTniEtiatlWrLgchiityoyhtEdFMSla--eMioyi-Rosa--ygdueEculHi-Tnu-CtteMnerNucyDdo&Diss-igoHosgnECCkceauNSreuioHrH-lC1iioc-atDctwLAnrTyynclo0cneFL-tiuaPpeec2e3n36oa-idoHta2C4-oe1cYg1--a773rSnioni3n0ErLehM4l65MA52cesno1dd-14t2nD3-Unsin7U02-PC0oD-PLeCnM61lJ2l2L-1i-rnoEe10aUNt91o0Acom1Fnx2De42g0BdepgnrH3G23ym1oari14-7i-2tsna11-0un13giFm04rE.0tH6e1•Ti-.BJo•1Bl2n.NM0dL0.g6"U3-2.12M1116U57213123 111111100000788888889999999900999991112566945577888999022346798 ENGLEnglish - PT467 53 VII. SPECIAL PROGRAMS EEXNSGSREExnegricnieseeri&ngSpCoorrteSc-iEeTnc2e03- FH 106 5577 Addenda-UniversityBulletin 117 FIRFinance/Insurance/Real Estate-BO402 57 AdultStudentDevelopment/MINI CollegeOfferings 117 FRENFrench- DH375 59 General EducationProgram 119 GGGGHEREEAOEORDLKMGM/GGHGGreeeEeaorOlegmtPkrhaa-nAGpDdeh-mHoyiDln3H-oi7sJg35tyNr7a&51t0iG7oeno-phCyLsi4c2s7-SM402E 6566612922 OWUUnnfeiifevv-eekCrressaniimttdpyyuCHCsoooulOnrlfoefsregesreiOPnfrgfsoegrirnagmsOfferings 111122222300 HEBRHebrew- DH375 62 MISCELLANEOUS INFORMATION HIADHigherEducation-PT 113 62 VIII. HISTHistory-Ml 100 63 PrivacyRightsofParentsandStudents 126 HLTH Health-FH 106 65 CrimeAwarenessandCampusSecurityAct 126 HHHPMPESRREOHHHeeuaalmlttahhn/PPhMryoosvmioectamileonEntdu-ScFacHtiie1on0nc6/eRsec&reEadtuicoanti-oFnH-F10H6106 666556 PMaarpkianngdBuildingAbbreviations 112287 ICLInstructionalCurriculumLeadership- ED404 66 TheUniversityofMemphisisaccreditedbytheCommissiononCollegesofthe SouthernAssociationofCollegesandSchoolstoawardbachelor's,firstprofessional,master's, educationspecialist's,doctorofeducationanddoctorofphilosophydegrees.TheUniversityofMemphisisoneof46institutionsintheTennesseeBoardofRegentssystem,the seventhlargestsystemofhighereducationinthenation.TheTennesseeBoardotRegentsisthegoverningboardforthissystemwhichiscompriseaofsixuniversities,tourteen communitycollegesandtwenty-sixareatechnologycenters.TheTBRsystemenrollsmorethan80%otallTennesseestudentsattendingpublicinstitutionsofhighereducation. TheUniversityofMemphisoffersequaleducationopportunitytoallpersonswithoutregardrace, religion, sex,creed,color, nationalorigin,ordisability. TheUniversitydoesnoi discriminateonthesebasesintherecruitmentnndadmissionofstudentsandtheoperationofanyofitsprogramsandactivities,asspecifiedbyFederalLawsandregulations.The designatedcoordinatorsforUniversitycompliancewith Section 504oftheRehabilitationActof 1973andTheAmericanswith DisabilitiesActof 1990aretheVicePresidentfor StudentAffairsandViceProvostforEnrollmentServicesandtheEqualEmploymentComplianceOfficer.Uponrequest,informationcontainedinthisdocumentwillbeprovidedin alternateformat. FALL 1995 THE UNIVERSITY OF MEMPHIS . FALL 1995 CALENDAR April 3 - 28 Registration for Continuing and Readmitted Students May 1 - June 30 Schedule Adjustments forstudents who selected courses in April June Registration for New Undergraduate Students August 1 Fee Payment Deadline forALL registered students August 17-18 Registration and Fee Paymentfor New Graduate Students August 21-22 Schedule Adjustmentfor Enrolled Students August 23-25 Last Call Registration and Fee Paymentfor Fall 1995 August 25 100% Refund Deadline - last day to withdrawfrom Fall 1995 classes and receive 100% refund August 25-26 Residence Hall Check-In August 28 FIRST DAY OF CLASSES August 28-31 Schedule Adjustments and Late Registration with $25.00 Penalty BeginningSeptember1, inquiriesconcerningscheduleadjustmentsshouldbedirectedto StudentInformation Services, Room 119Administration Building,678-2671 September4 HOLIDAY: Labor Day September7 Last day for Graduate Studentsto file "Intent to Graduate" and Candidacy Formswith Graduate School fordegrees to be conferred December 1995 September27 Last day to remove Summer '95 undergraduate level "Incomplete" grade September 8 75% Refund Deadline - last dayto withdraw (drop) from Fall 1995 classes and receive a 75% refund September22 25% Refund Deadline - last day to withdraw (drop) from Fall 1995 classes and receive a 25% refund October 16 Last day to withdraw (drop) from Fall 1995 classes (no refund) November SPRING 1996 REGISTRATION FOR CONTINUING STUDENTS (detailedtimetablein Spring 1996ScheduleofClasses) November 13 Last dayto remove Summer '95 graduate level "Incomplete" grade November 17 Last day to submit draft ofdefended Thesis/Dissertation to Graduate School November22 Last day to make application to the dean ofthe appropriate undergraduate college fordegreesto be conferred in May 1996 November23-26 HOLIDAY: THANKSGIVING November 1 Student Financial Aid Priority Deadline for Spring 1996 December 1 Last day to submit final copy ofThesis/Dissertation/Comprehensive Examination resultsto the Graduate School December6 LAST DAY OF CLASSES -Wednesday December7 STUDY DAY - Thursday December8-14 FINAL EXAMINATION PERIOD-See Examination Schedule December 15 Last dayto clearfinancial obligations to the University before holds are placed on grades December 15 Residence Hall Check-Out Deadline December 16 COMMENCEMENT -Saturday FALL 1995 THE UNIVERSITY OF MEMPHIS 11 ADMISSION READMISSION / All requirements for admission or readmission to the University must be completed before registration is authorized Any formerstudentwho was not enrolled in the Spring 1995 must apply for readmission. Any studentwho has nevertaken courses atthe Graduate level must apply for Graduate School admission. UNDERGRADUATE GRADUATE NEW STUDENTS Enrollment in courses numbered 5000 or above requires admission to the Graduate School. New undergraduate students must submit trts required application form and a $5.00 application fee to the NEW STUDENTS Office of Admissions on or before the deadline stated below. New graduate students must submit the required Applicants should submit all documents required to Graduate Admissions Application and a $5.00 complete their admission file and receive notificaiton of application fee on or beforethe deadline stated below. acceptance before attempting to register. 2. For full admission official transcripts and test scores must 3. If additional placement testing (AAPP) is required, be sent directly to The University of Memphis, Graduate students should contact the Office of Developmental Admissions Office, bythe issuing agency or institution. Studies at678-2028. 3. Unofficial documents may be used for admission to Registration for all new students occurs during an Graduate Non-Degree status. However, official documents orientation or information session. See page 9 for details. must be received from the issuing institutions during the firstterm ofenrollment. READMITS READMITS 1. Former undergraduate students who were not enrolled at The University of Memphis in Spring 1995 must Former graduate students who were not enrolled at The submita readmission application University of Memphis in Spring 1995 must submit a 2. Applicants should submit any required documents to readmission application. complete their readmission file and be notified of their Applicants should submit any required documents to acceptance before attempting to register Students who complete their readmission file and be notified of their have attended another institution since last enrolled at The acceptance before attempting to register. Students who University of Memphis must submit an official transcript have attended another institution since last enrolled at The from each institution priorto readmission. University of Memphis must submit an official transcript 3. After acceptance, applicants for readmission will be from each institution priorto readmission. notified oftheir registration opportunities. 4. It may be possible for students to complete readmission by telephone. Call (901) 678-2111 for further information. The DEADLINE for application for new and readmitted students is August 1. Appplicants who apply afterAugust 1 may not be admitted in time to register before classes start and may not be eligible for admission in a degree seeking category. They may be assessed a $25 late registration penalty. Applications for admission/readmission and information concerning procedures and regulations may be obtained from the following Admissions Offices in the Administration Building. Undergraduate Admissions/Readmissions Rm229 Admin. Bldg 678-2111 International Admissions Rm216 Admin. Bldg 678-291 Graduate Admissions Rm216 Admin. Bldg 678-291 Graduate Readmissions Rm315 Admin. Bldg 678-4489 RESIDENCY CLASSIFICATION For information concerning Tennessee Board of Regents guidelines and regulations for classification of in-state (resident) or out-of-state students forfee-paying purposes, direct all questions to: UndergraduateAdmissions Rm 229 Admin Bldg. 678-2344 GraduateAdmissions Rm 216 Admin. Bldg 678-2911 FALL 1995 THE UNIVERSITY OF MEMPHIS . ACADEMIC ADVISING ALL students at The University of Memphis must obtain an Advising/ Registration Planning Sheet from an advisor. Students should check the Registration Timetable for appointed advising times and contact the appropriate area listed below to set up an advising appointment in advance of the time for registration. ACADEMIC COUNSELING UNIT CHANGE OF COLLEGE/MAJOR/ADVISOR UNDERGRADUATE Scates Hall, Room 107, 678-2062 UNDERGRADUATE students may request a change in their college or major by completing an application at The Academic Counseling Unit advises students with the designated office ofthe college forthe new major. less than 25 semester hours completed (exceptions: Music majors should contact the Music Department and College/Office Location Telephone Engineering majors should contact the academic Arts & Sciences, Dean's Office Ml 217 678-3598 advisor in 301 Engineering) and undergraduate Business & Economics undecided major, non-degree, or audit students Advising Center BB 114 678-2855 (except those seeking some aspect of teacher licensure Communication & Fine Arts should contactthe College of Education). Dean's Office CFA 232 678-2350 Education, College Advisor ED 202 678-2728 ADVISING FOR STUDENTS Engineering, College Advisor EN 301 678-3247 WITH DECLARED MAJORS Nursing Newport Hall 678-2003 University College, Dean's Office JN G-1 678-2716 Students with declared majors (graduate or GRADUATE students may clarify their eligibility to undergraduate) should contact the department of their change their major or classification by contacting the major. (Exceptions: pre-professional students contact Graduate School Office, Room 315, Administration the Pre-Professional Advising Office in 207 Mitchell Hall Building. and Business majors will contact the Business Advising Office in 114 Business Office Building). ADVISOR changes may be requested by making application to the college in which the student is Graduate Non-Degree Students should contact the enrolled. advising office locations for the college in which coursework will be taken. Contact the Graduate School foradditional information, 678-2531. Off-Campus and Jackson Center Students should contact The University of Memphis Office on the Jackson State Community College campus at (901) 427-4725 or 678-5087 (local Memphis call). UNDERGRADUATE ADVISING GUIDELINES 1 See advisor according to the designated schedule. 2. Refer to your degree posting sheet and knowwhat you need to take. 3. Plan coursework semester by semester; try to complete lower division courses (1000-2000) before taking upper division courses (3000-4000). 4. Complete your trial schedule plan selecting several alternate sections or courses. 5. Register at your assigned window of time (See Registration Timetable). 6. Check your catalog to ensure that you have completed prerequisites. 7. Update your degree posting sheet at the end of each term. 8. Read your catalog and keep a copy with your degree posting sheet. You are ultimately responsible for completing the appropriate requirements for the degree program. 9. Retain copies of important documents for reference. FALL 1995 THE UNIVERSITY OF MEMPHIS APRIL REGISTRATION 1995 Fall CONTINUING & READMITTED STUDENTS All continuing and readmitted students are expected to REGISTRATION HOLDS register for the Fall 1995 semester in April according to the following Registration Timetable. Registered Registration may not be processed by students who have students may make schedule adjustments for Fall 1995 registration holds. Financial obligations to the University do in the Registration Center in April or during May and not restrict eligibilityto register; however all outstanding debts June in Student Information Services. Students must be paid in order to complete the registration process at readmitted after April 28th will be assigned another thetime offee payment. Students are responsible for clearing registration time in June (contact Admissions for aclolurhsoelsd.s Aprniyorhotoldsenptlearicnegd ptrhieorRteogitshteramtaiiolningCeonfteRregitsotrsaetlieocnt details). Permits for continuing students will be indicated on the form. STEPS REQUIRED FOR REGISTRATION Seethe list belowfor contact offices. HoldCode-Reason OfficeLocation - Telephone 1. Receive Registration Permit - mailed approximately 1-7,11,13,16,17,27,30,34 ApplicantSvcs Admin209 678-3933 March 23rd. This is the only permit continuing 12-HealthCenter HealthCntr200 678-2287 students will receive. 14- HighSchool Deficiency Admin 117 678-2393 2. Schedule Advising Appointment - all students 2190--HJeuadlitchialCeAnftfearir*s UHneiavltChenCtnetrr120050 667788--32122978 must obtain an Advising/Registration Planning Sheet 21 -InternationalStudents UnivCenter409 678-4271 from their advisor. Detailed advising information is 22.S6-DevelopmentalStudies Admin 171 678-2028 available from advising locations. Students should 23,24-OfficeoftheRegistrar Admin 119 678-2671 take advantage ofthe appropriate windows oftime. 'Students born after 1956 must furnish documented proof of having 3. Register at the assigned window oftime based on immunityor having been immunized with the live measles vaccine after classification and last name for a pleasant and January1, 1980,toHealth Servicesorregistrationwillbeheld. efficient experience. For students who are unable to NOTE: Regardless of current academic status, students will be come at the window of time during the day, we offer allowed to select classes for the following term(s). However, an alternate time the same evening. If neither of students whose final grades for any term result in an academic thhoewseevetri,metsheisapmoossuinbtle,ofmtaikmee iutpwidllaytsakaeretoavraeigliasbtleer; sbbeeufsaopfrefenecsttiheeodn.newSxietlleteAbrcema'adsuetcmolimacastsRieecsgaulblleyagtiwini.otnh/FdAircnaaadnwcenimaiflcroaSimtdattehuliesgisUbeinclitivtieyornms.iatyy will be greater the longer registration is postponed. Alphabetletters willbe rotatedeach term. NOTE: Summer and Fall registrations may be processed at the sametime. APRIL REGISTRATION 1995 Fall CONTINUING AND READMITTED STUDENTS Graduate Students* College Advising Registration Time Alternate Time laa-Mzz March27-31 April3 9am-10am April3 4-7pm Naa-Sil March27-31 April3 10am-11am April3 4-7pm Sim-Zzz March27-31 April3 11am-12pm April3 4-7pm Aaa-Czz March27-31 April3 1pm- 2pm April3 4-7pm Daa-Hzz March27-31 April3 2pm- 3pm April3 4-7pm includesPostBaccalaureatestudents Registration MakeUpDatesforGRADUATEStudentsMonday-Thursday April 10-13, 17-209:00am-7:00pm Seniors College Advising Registration Time Alternate Time 85+ hours earned Gas-Hum March27or28 April4 9am-11am April4 4-7pm Hun-Lzz March27or28 April4 12pm- 2pm April4 4-7pm Maa-OIr March27or28 April4 2pm- 4pm April4 4-7pm Ols-Saq March 29or30 April5 9am-11am April5 4-7pm Sar-Tok March29or30 April5 12pm- 2pm April5 4-7pm Tol-Zzz March29or30 April5 2pm- 4pm April5 4-7pm Aaa-Brn March31 orApril3 April6 9am-11am April6 4-7pm Bro-Czz March31 orApril3 April6 12pm- 2pm April6 4-7pm Daa-Gar March31 orApril3 April6 2pm- 4pm April6 4-7pm Registration MakeUpDatesforSENIORS - FRIDAYS - April7, 14,21,28 - 9:00am-4:30pm FALL 1995 THE UNIVERSITY OF MEMPHIS 1 APRIL REGISTRATION 1995 Fall CONTINUING AND READMITTED STUDENTS Juniors College Advising Registration Time Alternate Time 5S ^84 hours earned Haa-Lam April4or5 April 1 9am- 11am April 10 4-7pm Lan-Ozz April4or5 April 10 12pm- 2pm April 10 4-7pm Paa-Sph April4or5 April 10 2pm- 4pm April 10 4-7pm Spi-Zzz April6or7 April 11 9am-11am April 11 4-7pm Aaa-Col April6or7 April 11 12pm- 2pm April 11 4-7pm Com-Gzz April6or7 April 11 2pm- 4pm April 11 4-7pm Registration MakeUpDatesforJUNIORS - FRIDAYS -April 14,21,28 - 9:00am-4:30pm Lower Division College Academic Registration Time Alternate Time Sophomores/Freshmen Advising Counseling 0-54 hours earned Advising Gri-Har Apr10or11 Feb20or21 April 12 9am-11am April 12 4-7pm Has-Hom Apr10or11 Feb21 or22 April 12 12pm- 2pm April 12 4-7pm Hon-Jdz Apr1 or1 Feb22or23 April 12 2pm- 4pm April 12 4-7pm Jea-Jzz Apr 10or 11 Feb23or27 April 13 9am-11am April 13 4-7pm Kaa-Laq Apr10or11 Feb27or28 April 13 12pm- 2pm April 13 4-7pm Lar-Lox Apr10or11 Feb28orMar1 April 13 2pm- 4pm April 13 4-7pm Registration MakeUpDatesforLOWERDIVISION (Gri-Lox) - FRIDAYS -April 14,21,28 - 9:00am-4:30pm Loy-Mcc Apr10or11 Mar1 or2 April 17 9am- 11am April 17 4-7pm Mcd-Mon Apr10or11 Mar2or6 April 17 12pm- 2pm April 17 4-7pm Moo-Nhz Apr10or11 Mar6or7 April 17 2pm- 4pm April 17 4-7pm Nia-Ped Apr10or11 Mar7or8 April 18 9am- 11am April 18 4-7pm Pee-Qzz Apr12or13 Mar8or9 April 18 12pm- 2pm April 18 4-7pm Raa-Rob Apr12or13 Mar9or13 April 18 2pm- 4pm April 18 4-7pm Roc-Sbz Apr12or13 Mar13or14 April 19 9am- 11am April 19 4-7pm Sca-Shz Apr12or13 Mar14or15 April 19 12pm- 2pm April 19 4-7pm Sia-Spn Apr12or13 Mar15or16 April 19 2pm- 4pm April 19 4-7pm Spo-Tax Apr12or13 Mar16or27 April20 9am- 11am April20 4-7pm Tay-Trz Apr12or13 Mar27or28 April20 12pm- 2pm April20 4-7pm Tsa-Wdz Apr12or13 Mar28or29 April20 2pm- 4pm April20 4-7pm Registration MakeUpDatesforLOWERDIVISION (Loy-Wdz) - FRIDAYS - April21,28 - 9:00am-4:30pm Wea-Wim Apr12or13 Mar29or30 April24 9am-11am April24 4-7pm Win-Zzz Apr12or13 Mar30orApr4 April24 12pm- 2pm April24 4-7pm Aaa-Bag Apr 19or20 Apr4or5 April24 2pm- 4pm April24 4-7pm Bah-Bis Apr19or20 Apr5or6 April25 9am-11am April25 4-7pm Bit-Brn Apr19or20 Apr6or10 April25 12pm- 2pm April25 4-7pm Bro-Caq Apr19or20 Apr10or11 April25 2pm- 4pm April25 4-7pm Car-Cok Apr19or20 April or12 April26 9am- 11am April26 4-7pm Col-Czz Apr 19or20 Apr 12or 13 April26 12pm- 2pm April26 4-7pm Daa-Drt Apr19or20 Apr13or17 April26 2pm- 4pm April26 4-7pm Dm-Fdz Apr19or20 Apr17or18 April27 9am- 11am April27 4-7pm Fea-Gam Apr19or20 Apr18or19 April27 12pm- 2pm April27 4-7pm Gan-Grh Apr19or20 Apr19or20 April27 2pm- 4pm April27 4-7pm RegistrationMakeUpDateforALLCONTINUING&READMITTEDStudents(A-Z)-FRIDAY -April28 -9:00am-4:30pm ATTENTION: Students who satisfy fees using PC-191 (State of Tennessee Higher Education Employee), State of Tennessee employee, and Graduate Staff Scholarship waivers must register for those courses August 23-25 according to the Registration Timetable forthose days. OPPORTUNITIES FOR SCHEDULE ADJUSTMENTS Schedule adjustmentswill be processed in the Registration CenterApril 3-28. Registration Center Hours: Monday -Thursday9:00am -7:00pm, Friday9:00am -4:30pm Scheduleadjustmentswill be processed in Student Information Services, 119 Administration Bldg, May 1-June 30. Hours ofOperation: Monday -Thursday7:30am-7:00pm, Friday7:30am-4:30pm Saturday8:30am-noon , Schedule adjustmentswill be processed inthe Registration Center, August 21 - 22 according to thetimetable on page 9. FALL 1995 THE UNIVERSITY OF MEMPHIS JUNE REGISTRATION 1995 Fall NEW UNDERGRADUATE STUDENTS June is New Student Month at The University of Memphis. Enrollment Services concentrates its efforts for the entire month on making the new student's transition to our student body as pleasant as possible. The University believes that a pleasant and informative initial experience is critical to both retention and success in the undergraduate collegiate experience. For this reason all new undergraduates are required to attend either an orientation session or an information session as a part oftheir initial registration experience. Orientation/Information Sessions Before scheduling a date for an orientation/information session, all new students must have met all admission requirements, have had all transcripts evaluated, and have been notified of their acceptance. CURRENT HIGH SCHOOL GRADUATES Current year high school graduates should plan to attend one of the two-day orientation (N.S.O.) sessions designed for the traditional age college student. A nomminal fee is required to cover meals and overnight lodging. Parents are cordially invited and encouraged to attend these sessions. New Student Orientation N.S.O. Application IfPlacement Testing Is Required Reqistration Session Group MustBeReceived Bv: YourTest Date* Is: June5-6 Scholarship Freshmen June 1 June 3 June 12-13 Regular Freshmen June8 June 10 June 15-16 RegularFreshmen June 11 June 14 June 19-20 RegularFreshmen June 15 June 14 June22-23 RegularFreshmen June 18 June 14 'Studentstraveling morethan 50 milestoThe Universityof Memphis campus mayarrange fora specialtestdate ontheafternoon beforethetwo day New StudentOrientation(NSO)program. Tomaketestarrangements,call(901)678-2028. ArrangementsmustbemadepriortoarrivalattheUniversity. OTHER NEW UNDERGRADUATE STUDENTS All other new undergraduate students (both transfer and first time college) should plan to attend one of the Advising, Information, Registration (AIR) sessions listed below. Both day and evening sessions are available. Advising/Information/ A.I.R. Application IfPlacementTesting Is Required Reqistration Session Group MustBeReceived By: YourTest Date* Is: June26AM RegularFreshmen June22 June22 June26 PM Regular Freshmen June22 June22 June27AM Transfer Students June23 June26 June27 PM Transfer Students June23 June26 June28AM TransferStudents June24 June26 June 28 PM Transfer Students June24 June26 June29AM TransferStudents June25 June26 June29 PM Transfer Students June25 June26 June 30AM TransferStudents June26 June26 June 30 PM Transfer Students June26 June26 •Studentstraveling morethan 50milestoThe UniversityofMemphiscampus mayarrangefor aspecialtestdateontheafternoon beforetheAdvising, information, Registration(AIR)Session Tomaketestarrangements,call(901)678-2028. Arrangementsmustbemadepriortoarrivalattheuniversity. Information regarding specific dates and scheduling is available from Orientation Services in the Office of Admissions or by telephone at (901) 678-5513. Registration for the Fall semester occurs during each orientation/information session. In order to provide the best services possible, all sessions must be scheduled in advance. Walk-ins are not permitted at any session. Do not plan to come to either an orientation or information session until your scheduled date is confirmed by Orientation Services. FALL 1995 8 THE UNIVERSITY OF MEMPHIS