ebook img

Research Article Synthesis, Molecular Docking Studies, and Antifungal Activity Evaluation of New ... PDF

16 Pages·2017·2.46 MB·English
by  
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Research Article Synthesis, Molecular Docking Studies, and Antifungal Activity Evaluation of New ...

Hindawi Journal of Chemistry Volume 2017, Article ID 9387102, 15 pages https://doi.org/10.1155/2017/9387102 Research Article Synthesis, Molecular Docking Studies, and Antifungal Activity Evaluation of New Benzimidazole-Triazoles as Potential 𝛼 Lanosterol 14 -Demethylase Inhibitors NafizÖncüCan,1,2UlviyeAcarÇevik,2,3BegümNurpelinSaLlJk,2,3SerkanLevent,2,3 BüGraKorkut,4YusufÖzkay,2,3ZaferAsJmKaplancJklJ,2andAliSavaGKoparal5 1DepartmentofAnalyticalChemistry,FacultyofPharmacy,AnadoluUniversity,26470Eski¸sehir,Turkey 2DepartmentofPharmaceuticalChemistry,FacultyofPharmacy,AnadoluUniversity,26470Eski¸sehir,Turkey 3DopingandNarcoticCompoundsAnalysisLaboratory,FacultyofPharmacy,AnadoluUniversity,26470Eski¸sehir,Turkey 4DepartmentofPharmaceuticalToxicology,FacultyofPharmacy,AnadoluUniversity,26470Eski¸sehir,Turkey 5DepartmentofEnvironmentalEngineering,FacultyofEngineering,AnadoluUniversity,Eski¸sehir,Turkey CorrespondenceshouldbeaddressedtoYusufO¨zkay;[email protected] Received 8 August 2017; Accepted 9 October 2017; Published 12 December 2017 AcademicEditor:GabrielNavarrete-Vazquez Copyright©2017NafizO¨ncu¨Canetal.ThisisanopenaccessarticledistributedundertheCreativeCommonsAttributionLicense, whichpermitsunrestricteduse,distribution,andreproductioninanymedium,providedtheoriginalworkisproperlycited. Duetoanticandidalimportanceofazolecompounds,anewseriesofbenzimidazole-triazolederivatives(5a–5s)weredesignedand synthesizedasergosterolinhibitors.Thechemicalstructuresofthetargetcompoundswerecharacterizedbyspectroscopicmethods. ThefinalcompoundswerescreenedforantifungalactivityagainstCandidaglabrata(ATCC90030),Candidakrusei(ATCC6258), Candidaparapsilosis(ATCC22019),andCandidaalbicans(ATCC24433).Compounds5iand5sexhibitedsignificantinhibitory activityagainstCandidastrainswithMIC50valuesrangingfrom0.78to1.56𝜇g/mL.CytotoxicityresultsrevealedthatIC50valuesof compounds5iand5sagainstNIH/3T3aresignificantlyhigherthantheirMIC50values.Effectofthecompounds5iand5sagainst ergosterolbiosynthesiswasdeterminedbyLC-MS-MSanalysis.Bothcompoundscausedasignificantdecreaseintheergosterol level.Themoleculardockingstudieswereperformedtoinvestigatetheinteractionmodesbetweenthecompoundsandactivesite oflanosterol14-𝛼-demethylase(CYP51),whichisasatargetenzymeforanticandidalazoles.TheoreticalADMEpredictionswere alsocalculatedforfinalcompounds. 1.Introduction inhibitors (5-fluorocytosine) (Figure1) [3]. Due to its high therapeuticindex,azolesarefirst-linedrugsforthetreatment Recently, the incidence of systemic fungal infection has ofinvasivefungalinfections[4,5].Mosttherapies,designed become an important complication and a major cause of to treat fungal infections, target the ergosterol biosynthesis morbidity and mortality in immune compromised individ- pathwayoritsendproduct[6]. ualssuchaspatientsundergoinganticancerchemotherapyor Infungi,lanosterol14-𝛼-demethylase(CYP51)belongsto organ transplants and patients with AIDS [1, 2]. According a superfamily of monooxygenases called cytochrome P450, to the mechanism of action, there are six classes of anti- whichcatalyzestheoxidativeremovalofthe14-methylgroup fungal agents: fungalergosterol synthesis inhibitors(azoles: (C-32) of lanosterol to give 14,15-desaturated intermediates ketoconazole,fluconazole,andvoriconazole),glucansynthe- inergosterolbiosynthesis.CYP51isoneofthekeyenzymes sis inhibitors (echinocandins and caspofungin), ergosterol of sterol biosynthesis in different biological kingdoms and disruptors (polyenes antibiotics: amphotericin B), squalene serves the metabolic function such as membrane perme- epoxidase inhibitors (terbinafine and naftifine), chitin syn- ability,membranefluidity,enzymeactivity,cellmorphology, thesis inhibitors (nikkomycin), and nucleic acid synthesis andcellcycleprogression[7–9].Thisenzymeisfoundinall 2 JournalofChemistry N Ergosterol synthesis inhibitors N N Cl N HO N O O N Cl N N N N N N N O O OH F F N F F F N Ketoconazole Fluconazole Voriconazole Glucan synthesis inhibitors OH O H ( . N HO OH 2 O NH O NH HN OH HO (2. N O O O O N HN OH O O O N O HO HN HO NH N HO NH OH H O N OH OH HO OH O OH HO Echinocandins Caspofungin .( Chitin synthesis inhibitors Ergosterol disruptor 2OH HO O OH .(2 H O N N OH O O HO O OH COOH OH OH OH OH O O HO N OH O OH O OH OH NH O Amphotericin B Nikkomycin Squalene epoxidase inhibitors Nucleic acid synthesis inhibitors N .( N 2 F N N O H Terbinafine Naftifine 5-Fluorocytosine Figure1:Chemicalstructuresofsomeantifungaldrugswhichareinclinicaluse. JournalofChemistry 3 eukaryotes(includinghumans)andbecausetheazolesinter- samereactionconditionsinmicrowavereactor.Themixture act also with other cytochrome P450-dependent enzymes was cooled and poured into iced-water. The obtained solid (CYP3A4), a selective inhibition of the enzyme is essential wasfiltered,washedwithwater,dried,andrecrystallizedfrom foranincreasedtherapeuticindex[10–12]. ethanoltogainproductwith86%yields. In general, the active site of CYP51 is divided into four subsites: a coordination bond with iron of the heme group, 2.1.2. 4-(5(6)-Methyl-1H-benzimidazol-2-yl)benzohydrazide thehydrophobicregion,thehydrophilicH-bondingregion, (2). Methyl4-(5-methyl-1H-benzimidazol-2-yl)benzoate(1) andthenarrowhydrophobiccleftformed.Theaffinityofazole (2.66g, 0.01mol) and hydrazine hydrate (5mL) in ethanol ∘ antifungalstothelanosterol14a-demethylaseisdetermined (15mL) were heated under the conditions of 150 C and 10 notonlybythecoordinationbindingofthenitrogenofazole bar for 10min in microwave synthesis reactor (Anton-Paar ringtothehemeironintheactiveside(N-4oftriazoleand Monowave300,Austria).Themixturewascooledandpoured N-3ofimidazole)butalsobytheaffinityofN-lsubstituentfor intoiced-water.Theobtainedsolidwasfiltered,washedwith theapoproteinpartoftheenzyme.Theremainingpartofthe water,dried,andrecrystallizedfromethanoltogainproduct azoleantifungalfitsinthesimilarwaylikelanosterolinthe with92%yields. hydrophobicgrooveoflanosterol14-𝛼-demethylase[13–17]. BasedonthesepropertiesoftheactivesiteofCYP51,we 2.1.3.N-Alkyl-2-[4-(5(6)-methyl-1H-benzimidazol-2-yl)ben- areprovidedwithanattempttodesignnewazolederivatives zoyl]hydrazine-1-carbothioamide (3a, 3b). 4-(5-Methyl-1H- to find potent systemic antifungal agents that have a broad benzimidazol-2-yl)benzohydrazide(2)(2.66g,0.01mol)and antifungalspectrumbutwithlesspotentialtodevelopdrug methylisothiocyanateorethylisothiocyanate(0.012mol)in resistance. Several studies have been performed, and many ethanol were refluxed for 2h. The precipitated product was ofthemhavesupportedthefindingthatbenzimidazoleand filtered,washedwithethanol,anddried.Compounds3aand triazoleringsweresignificantstructuralmoietiesforantifun- 3bwereobtainedwithyieldsof78%and81%,respectively. galactivity[18–28].Inthepresentstudy,promptedfromanti- 2.1.4. 4-Alkyl-5-[4-(5(6)-methyl-1H-benzimidazol-2-yl)phe- candidalpotentialofazolecompounds,newbenzimidazole- nyl)]-4H-1,2,4-triazole-3-thiol (4a-4b). N-Alkyl-2-[4-(5(6)- triazole hybrid compounds were synthesized and evaluated methyl-1H-benzimidazol-2-yl)benzoyl]hydrazine-1-carboth- forantifungalactivity. ioamide(3a,3b) (0.001mol) in ethanol was refluxed under 2.Experimental stirring for 2h in the presence of NaOH (0.012mol). After completionofreaction,thesolutionwasacidifiedwithHCl 2.1. Chemistry. Entire chemicals used in the study were 37%; the precipitate was filtered, washed with water, dried, purchasedfromeitherSigma-Aldrich(Sigma-AldrichCorp., andthenrecrystallizedfromethanol.Compounds4aand4b St. Louis, MO, USA) or Merck (Merck KGaA, Darm- wereobtainedwithyieldsof71%and73%,respectively. stadt, Germany) and used without further chemical or 2.1.5. 2-(4-(4-Alkyl-5-(2-(substitutedphenyl)-2-oxo-ethylthio)- biological purification. Microwave syntheses were realized 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole by using a Monowave 300 high-performance microwave (5a–5s). A solution of 4a or 4b (0.001mol) in acetone reactor (Anton-Paar, Austria). Melting points of synthe- (10mL), an appropriate substituted 2-bromoacetophenone sized compounds were determined by using an automatic derivative (0.001mol), and potassium carbonate (0.138g, melting point determination system (MP90 series, Mettler- ∘ 1 0.001mol) were refluxed at 40 C for 12h. The solvent was Toledo, OH, USA) and were presented as uncorrected. H 13 evaporated; residue was washed with water, dried, and and C NMR spectra were recorded in DMSO-d6 by a Bruker digital FT-NMR spectrometer (Bruker Bioscience, recrystallizedfromethanol. MA, USA) at 300MHz and 75MHz, respectively. The IR 2.1.6. 2-(4-(4-Methyl-5-(2-phenyl-2-oxo-ethylthio)-4H-1,2,4- spectraofthecompoundswererecordedusinganIRAffinity- triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole(5a). Yield: 1S Fourier transform IR (FTIR) spectrometer (Shimadzu, ∘ −1 Kyoto, Japan). High resolution mass spectrometric studies 81%. M.p. 247-248 C. FTIR (ATR, cm ): 3211 (N-H), 1 wereperformedusinganLCMS-IT-TOFsystem(Shimadzu, 1676(C=O),848(1,4-disubstitutedbenzeneC-H). H-NMR Kyoto, Japan). Chemical purities of the compounds were (300MHz, DMSO-d6): 𝛿 = 2.44 (3H, s, -CH3), 3.72 (3H, s, checkedbyclassicalTLCapplicationsperformedonsilicagel -CH3), 4.96 (2H, s, -CH2-), 7.07 (1H, d, J = 8.19Hz, Benz- 60F254(MerckKGaA,Darmstadt,Germany);LCMS-IT-TOF imidazole C-H), 7.42 (1H, s, Benzimidazole C-H), 7.51–7.60 chromatogramswerealsousedforthesamepurpose. (3H, m, Benzimidazole C-H, Monosubstituted Benzene C- H),7.70(1H,t,J =7.88Hz,MonosubstitutedBenzeneC-H), 2.1.1.Methyl4-(5(6)-Methyl-1H-benzimidazol-2-yl)benzoate 7.89(2H,d,J=8.35Hz,1,4-disubstitutedbenzeneC-H),8.04 (1). Inavial(30mL)ofmicrowavesynthesisreactor(Anton- (2H, d, J = 7.88Hz, Monosubstituted Benzene C-H), 8.32 Paar,Monowave300,Austria)equippedwithamagneticstir- (2H,d,J=8.35Hz,1,4-disubstitutedbenzeneC-H),13.15(1H, rer,asolutionofmethyl-4-formylbenzoate(2.4g,0.015mol) s, Benzimidazole -NH). 13C-NMR (75MHz, DMSO-d6): 𝛿 inDMF(10mL)andsodiumdisulfite(2.85g,0.015mol)were (ppm):21.81,32.49,41.27,115.76,124.54,126.83,127.18,128.42, ∘ heatedunderconditionsof240 Cand10barfor5min.After 128.93, 129.22, 129.31, 130.37, 131.62, 132.37, 134.26, 135.73, + thisstage,5-methyl-1,2-phenylenediamine(1.83g,0.015mol) 150.37,151.08,155.30,192.85.[M+H] calcdforC25H21N5OS: was added and then reaction mixture was kept under the 440.1540;found:440.1527. 4 JournalofChemistry 2.1.7. 2-(4-(4-Methyl-5-(2-(4-cyanophenyl)-2-oxo-ethylthio)- J = 8.37Hz, 1,4-disubstituted benzene C-H), 7.93 (2H, d, 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzoimidazole J = 8.12, 4-methylphenyl C-H), 8.31 (2H, d, J = 8.37Hz, (5b). Yield: 83%. M.p. 239-240∘C. FTIR (ATR, cm−1): 3093 1,4-disubstitutedbenzeneC-H),12.92(1H,s,Benzimidazole (N-H), 1680 (C=O), 849 (1,4-disubstituted benzene C-H). -NH). 13C-NMR (75MHz, DMSO-d6): 𝛿 (ppm): 21.68, 1H-NMR(300MHz,DMSO-d6):𝛿=2.49(3H,s,-CH3),3.74 21.82,32.48,41.25,111.75,119.21,124.28,127.09,128.28,129.05, (3H, s, -CH3), 4.99 (2H, s, -CH2-), 7.29 (1H, d, J = 8.28Hz, 129.20, 129.84, 130.77, 131.94, 132.80+, 133.22, 135.86, 144.79, Benzimidazole C-H), 7.57 (1H, s, Benzimidazole C-H), 7.67 150.47,151.06,155.31,193.39.[M+H] calcdforC26H23N5OS: 454.1696;found:454.1683. (1H, d, J = 8.28Hz, Benzimidazole C-H), 8.02 (2H, d, J = 8.45Hz,1,4-disubstitutedbenzeneC-H),8.06(2H,d,J=8.40, 2.1.11. 2-(4-(4-Methyl-5-(2-(4-chlorophenyl)-2-oxo-ethylthio)- 4-cyanophenyl C-H), 8.19 (2H, d, J = 8.40, 4-cyanophenyl 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole C-H), 8.36 (2H, d, J = 8.45Hz, 1,4-disubstituted benzene ∘ −1 13 (5f). Yield: 76%. M.p. 226-227 C. FTIR (ATR, cm ): 3190 C-H),13.32(1H,s,Benzimidazole-NH). C-NMR(75MHz, (N-H), 1680 (C=O), 850 (1,4-disubstituted benzene C-H). DMSO-d6):𝛿(ppm):21.73,32.59,41.13,114.31,114.84,116.03, 1H-NMR(300MHz,DMSO-d6):𝛿=2.44(3H,s,-CH3),3.71 118.56, 126.77, 127.59, 128.17, 129.47, 129.54, 130.16, 133.32, + (3H, s, -CH3), 4.93 (2H, s, -CH2-), 7.04 (1H, d, J = 8.55Hz, 135.06, 135.36, 139.04, 149.01, 151.26, 154.96, 193.43. [M+H] Benzimidazole C-H), 7.45 (1H, br.s, Benzimidazole C-H), calcdforC26H20N6OS:465.1492;found:465.1485. 7.57(1H,br.s,BenzimidazoleC-H),7.64(2H,d, J =8.55,4- chlorophenylC-H),7.88(2H,d,J=8.33Hz,1,4-disubstituted 2.1.8. 2-(4-(4-Methyl-5-(2-(4-fluorophenyl)-2-oxo-ethylthio)- benzene C-H), 8.05 (2H, d, J = 8.55, 4-chlorophenyl C-H), 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole ∘ −1 8.31 (2H, d, J = 8.33Hz, 1,4-disubstituted benzene C-H), (5c). Yield: 77%. M.p. 255-256 C. FTIR (ATR, cm ): 2968 13 12.93 (1H, s, Benzimidazole -NH). C-NMR (75MHz, 1(NH--HN)M, R16(83100(CM=HOz),,D84M3SO(1,-4d-6d)i:s𝛿ub=st2i.t4u3te(d3Hb,esn,z-eCnHe3C),-3H.7)1. D12M4.8S5O,-d1267).:0𝛿7,(p12p7m.13):,2112.896.2,03,2.14299,.4411,.121,3011.18.66,2,113119.9.172,,112332..9789,, (3H, s, -CH3), 4.94 (2H, s, -CH2-), 7.05 (1H, d, J = 8.13Hz, 134.45, 139.15, 142.45, 144.67, 150.90, 155.35, 193.12. [M+H]+ BenzimidazoleC-H),7.37–7.43(3H,m,4-FluorophenylC-H, calcdforC25H20ClN5OS:474.1150;found:474.1149. BenzimidazoleC-H),7.51(1H,d,J =8.13Hz,Benzimidazole C-H), 7.88 (2H, d, J = 8.31Hz, 1,4-disubstituted benzene 2.1.12. 2-(4-(4-Methyl-5-(2-(2,4-dichlorophenyl)-2-oxo-ethyl- C-H), 8.11–8.17 (2H, m, 4-Fluorophenyl C-H), 8.32 (2H, thio)-4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimid- ∘ −1 d, J = 8.31Hz, 1,4-disubstituted benzene C-H), 12.11 (1H, azole (5g). Yield: 74%. M.p. 159-160 C. FTIR (ATR, cm ): 13 s, Benzimidazole -NH). C-NMR (75MHz, DMSO-d6): 3305(N-H),1685(C=O),854(1,4-disubstitutedbenzeneC- 𝛿 (ppm): 21.81, 32.48, 41.10, 116.36 (d, J = 21.8Hz), 124.42, H).1H-NMR(300MHz,DMSO-d6):𝛿=2.45(3H,s,-CH3), 127.14,128.29,129.19,130.04,131.38,131.51,131.85,132.02(d,J 3.68 (3H, s, -CH3), 4.81 (2H, s, -CH2-), 7.10 (1H, d, J = =9.0Hz),132.22,132.49,132.51(d,J=3.0Hz),150.44,150.99, 8.22Hz, Benzimidazole C-H), 7.43 (1H, s, Benzimidazole + 155.33, 165.79 (d, J = 251.3Hz), 192.53. [M+H] calcd for C-H),7.54(1H,d,J=7.98Hz,BenzimidazoleC-H),7.61(1H, C25H20FN5OS:458.1445;found:458.1443. dd, J = 8.38Hz–2.01Hz Dichlorophenyl C-H), 7.78 (1H, d, J = 1.98Hz, Dichloropheyl), 7.90 (3H, m, 1,4-disubstituted 2.1.9. 2-(4-(4-Methyl-5-(2-(4-bromophenyl)-2-oxo-ethylthio)- benzeneC-H,DichlorophenylC-H),8.33(2H,d,J=8.43Hz, 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole 1,4-disubstitutedbenzeneC-H),13.28(1H,s,Benzimidazole ∘ −1 (5d). Yield: 75%. M.p. 259-260 C. FTIR (ATR, cm ): 3201 -NH).13C-NMR(75MHz,DMSO-d6):𝛿(ppm):21.81,32.09, (N-H), 1680 (C=O), 850 (1,4-disubstituted benzene C-H). 1H-NMR(300MHz,DMSO-d6):𝛿=2.43(3H,s,-CH3),3.71 41330.0.556,,11113.15.19,81,1193.129.,0172,413.020.1,11,21433.8.481,,112374.2.414,,121385.0.852,,112387..3227,,112493..2957,, (3H,s,-CH3),4.92(2H,s,-CH2-),7.05(1H,s,Benzimidazole + C-H),7.34–7.56(2H,m,Ar-H),7.78–7.95(6H,m,Ar-H),8.31 150.22, 154.89, 194.94. [M+H] calcd for C25H19Cl2N5OS: 13 508.0760;found:508.0755. (2H, s, Ar-H), 12.91 (1H, s, Benzimidazole -NH). C-NMR (75MHz, DMSO-d6): 𝛿 (ppm): 21.81, 32.48, 41.10, 111.63, 2.1.13. 2-(4-(4-Methyl-5-(2-(2,4-difluorophenyl)-2-oxo-ethyl- 119.13, 123.99, 124.85, 127.08, 128.39, 129.20, 130.92, 131.33, thio)-4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimid- 131.96, 132.36, 132.78, 134.77, 142.46, 150.31, 150.90, 155.35, ∘ −1 + azole(5h). Yield:82%.M.p.258-259 C.FTIR(ATR,cm ): 193.23. [M+H] calcd for C25H20BrN5OS: 518.0645; found: 3196 (N-H), 1676 (C=O), 850 (1,4-disubstituted benzene C- 518.0635. H).1H-NMR(300MHz,DMSO-d6):𝛿=2.44(3H,s,-CH3), 2.1.10. 2-(4-(4-Methyl-5-(2-(4-methylphenyl)-2-oxo-ethylthio)- 3.71(3H,s,-CH3),4.83(2H,s,-CH2-),7.05(1H,d,J=8.40Hz, 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole BenzimidazoleC-H),7.25–7.34(2H,m,Ar-H),7.43–7.58(2H, (5e). Yield: 78%. M.p. 261-262∘C. FTIR (ATR, cm−1): 3197 m,Ar-H),7.89(2H,d,J=8.33Hz,1,4-disubstitutedbenzene (N-H), 1674 (C=O), 850 (1,4-disubstituted benzene C-H). C-H), 7.98–8.06 (1H, m, Ar-H), 8.31 (2H, d, J = 8.33Hz, 1H-NMR (300MHz, DMSO-d6): 𝛿 = 2.39 (3H, s, -CH3), 1,4-disubstituted benzene C-H), 12.92 (1H, s, Benzimida- 2.44 (3H, s, -CH3), 3.70 (3H, s, -CH3), 4.91 (2H, s, -CH2-), zole -NH). 13C-NMR (75MHz, DMSO-d6): 𝛿 (ppm): 21.86, 7.07 (1H, d, J = 8.13Hz, Benzimidazole C-H), 7.37 (2H, d, J 32.45, 44.29, 105.79 (t, J = 26.81Hz), 111.62, 113.03 (dd, J = = 8.12, 4-methylphenyl C-H), 7.41 (1H, br.s, Benzimidazole 24.98Hz–3.31Hz),119.12,123.99,124.85,127.07,128.22,129.21, C-H), 7.51 (1H, br.s, Benzimidazole C-H), 7.88 (2H, d, 131.96,132.77,133.38(dd,J=10.97Hz–3.83Hz),135.80,142.45, JournalofChemistry 5 144.67, 150.94, 155.34, 164.0, 164.24, 190.38 (d, J = 3.76Hz). (N-H), 1683 (C=O), 850 (1,4-disubstituted benzene C-H). [M+H]+calcdforC25H19F2N5OS:476.1351;found:476.1348. 1H-NMR (300MHz, DMSO-d6): 𝛿 = 1.28 (3H, t, J = 7.13, -CH3),2.43(3H,s,-CH3),4.12(2H,q,J=7.13Hz,-CH2),5.00 2.1.14. 2-(4-(4-Methyl-5-(2-(3,4-dihydroxyphenyl)-2-oxo-eth- (2H,s,-CH2-),7.05(1H,d,J=8.28Hz,BenzimidazoleC-H), ylthio)-4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzim- 7.38–7.43 (3H, m, Fluorophenyl C-H, Benzimidazole C-H), ∘ −1 idazole(5i). Yield:79%.M.p.249-250 C.FTIR(ATR,cm ): 7.56 (1H, d, J = 8.28Hz, Benzimidazole C-H), 7.82 (2H, d, J 3041 (N-H), 1681 (C=O), 854 (1,4-disubstituted benzene C- =8.16Hz,1,4-disubstitutedbenzeneC-H),8.12–8.17(2H,m, H).1H-NMR(300MHz,DMSO-d6):𝛿=2.43(3H,s,-CH3), FluorophenylC-H),8.33(2H,d,J=8.16Hz,1,4-disubstituted 3.70 (3H, s, -CH3), 4.81 (2H, s, -CH2-), 6.85 (1H, d, J = benzeneC-H),13.05(1H,s,Benzimidazole-NH).13C-NMR 8.25Hz, Dihydroxyphenyl C-H), 7.05 (1H, d, J = 7.95Hz, (75MHz, DMSO-d6): 𝛿 (ppm): 15.53, 21.80, 40.80, 41.11, Benzimidazole C-H), 7.39–7.46 (4H, m, Dihydroxyphenyl 116.37 (d, J = 21.9Hz), 119.10, 119.22, 123.96, 124.82, 128.37, C-H, Benzimidazole C-H), 7.88 (2H, d, J = 8.45Hz, 1,4- 129.22, 131.29, 132.02 (d, J = 9.5Hz), 132.55 (d, J = 3.0Hz), disubstituted benzene C-H), 8.31 (2H, d, J = 8.45Hz, 1,4- 135.85, 142.44, 144.65, 150.28, 150.46, 154.83, 165.78 (d, J = disubstituted benzene C-H), 12.86 (1H, s, Benzimidazole - + NH).13C-NMR(75MHz,DMSO-d6):𝛿(ppm):21.81,32.45, 251.1Hz),192.41.[M+H] calcdforC26H22FN5OS:472.1602; found:472.1604. 41.07,111.53,115.63,119.09,119.25,122.52,126.26,127.09,127.47, 128.31, 129.04, 129.20, 130.44, 131.92, 134.68, 138.29, 145.85, + 2.1.18. 2-(4-(4-Ethyl-5-(2-(4-bromophenyl)-2-oxo-ethylthio)- 151.26,151.91,155.28,191.88.[M+H] calcdforC25H21N5O3S: 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole 472.1438;found:472.1439. ∘ −1 (5m). Yield: 81%. M.p. 186-187 C. FTIR (ATR, cm ): 3122 1 2.1.15. 2-(4-(4-Ethyl-5-(2-phenyl-2-oxo-ethylthio)-4H-1,2,4-tri- (N-H), 1680 (C=O), 850 (1,4-disubstituted benzen). H- azol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole (5j). Yield: NMR(300MHz,DMSO-d6):𝛿=1.28(3H,t,J=7.16,-CH3), 83%. M.p. 235-236∘C. FTIR (ATR, cm−1): 3255 (N-H), 2.44(3H,s,-CH3),4.11(2H,q,J =7.16Hz,-CH2),4.99(2H, 1680(C=O),848(1,4-disubstitutedbenzeneC-H).1H-NMR s, -CH2-), 7.06 (1H, d, J = 8.18Hz, Benzimidazole C-H), (300MHz, DMSO-d6): 𝛿 = 1.29 (3H, t, J = 7.14, -CH3), 7.41 (1H, s, Benzimidazole C-H), 7.52 (1H, d, J = 8.18Hz, 2.50 (3H, s, -CH3), 4.15 (2H, q, J = 7.14Hz, -CH2), 5.04 Benzimidazole C-H), 7.78–7.84 (4H, m, 1,4-disubstituted (2H, s, -CH2-), 7.33 (1H, d, J = 8.31Hz, Benzimidazole benzene, 4-bromophenyl), 7.98 (2H, d, J = 8.55Hz, 4- C-H), 7.55–7.60 (3H, m, Benzimidazole C-H, Monosubsti- bromophenyl), 8.32 (2H, d, J = 8.37Hz, 1,4-disubstituted 13 tutedBenzeneC-H),7.69–7.72(2H,m,BenzimidazoleC-H, benzene C-H), 12.97 (1H, s, Benzimidazole -NH). C- Monosubstituted Benzene C-H), 7.99 (2H, d, J = 8.24Hz, NMR (75MHz, DMSO-d6): 𝛿 (ppm): 15.53, 21.81, 40.79, 1,4-disubstituted benzene C-H), 8.06 (2H, d, J = 7.44Hz, 41.06, 112.35, 120.74, 124.48, 127.05, 127.28, 128.39, 128.49, Monosubstituted Benzene C-H), 8.39 (2H, d, J = 8.24Hz, 128.74, 129.26, 130.92, 131.44, 131.89, 132.38, 133.18, 134.81, 1,4-disubstituted benzene C-H), 13.24 (1H, s, Benzimida- 140.65, 150.38, 150.41, 154.81, 193.10. [M+H]+ calcd for zole-NH).13C-NMR(75MHz,DMSO-d6):𝛿(ppm):15.49, C26H22BrN5OS:532.0801;found:532.0801. 21.72,40.80,41.21,114.19,114.65,126.88,127.21,128.52,128.91, 129.33, 129.57, 130.75, 132.69, 134.28, 134.52, 135.59, 135.76, 2.1.19. 2-(4-(4-Ethyl-5-(2-(4-methylphenyl)-2-oxo-ethylthio)- + 148.69,151.09,154.27,193.63.[M+H] calcdforC26H23N5OS: 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole 454.1696;found:454.1683. ∘ −1 (5n). Yield: 76%. M.p. 249-250 C. FTIR (ATR, cm ): 3163 (N-H), 1678 (C=O), 852 (1,4-disubstituted benzen). 2.1.16. 2-(4-(4-Ethyl-5-(2-(4-cyanophenyl)-2-oxo-ethylthio)- 1H-NMR (300MHz, DMSO-d6): 𝛿 = 1.27 (3H, t, J = 7.19, 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole ∘ −1 -CH3), 2.39 (3H, s, -CH3), 2.43 (3H, s, -CH3), 4.11 (2H, (5k). Yield: 80%. M.p. 181-182 C. FTIR (ATR, cm ): 2987 q, J = 7.17Hz, -CH2), 4.98 (2H, s, -CH2-), 7.06 (1H, d, (N-H), 1676 (C=O), 849 (1,4-disubstituted benzene C-H). 1H-NMR (300MHz, DMSO-d6): 𝛿 = 1.28 (3H, t, J = 7.20, 4J-m=e8t.h2y2lpHhze,nBylenCz-imHi)d,a7z.o4l1e(C1H-H, )s,,7.B37en(z2imHi,ddaz,oJle=C8-.H09),, -CH3), 2.44 (3H, s, -CH3), 4.12 (2H, q, J = 7.16Hz, -CH2), 7.52 (1H, d, J = 8.22Hz, Benzimidazole C-H), 7.82 (2H, d, 5.04(2H,s,-CH2-),7.06(1H,d,J =8.28Hz,Benzimidazole J = 8.37Hz, 1,4-disubstituted benzene C-H), 7.94 (2H, d, C-H), 7.41 (1H, s, Benzimidazole C-H), 7.52 (1H, d, J = J = 8.09, 4-methylphenyl C-H), 8.32 (2H, d, J = 8.37Hz, 8.28Hz, Benzimidazole C-H), 7.82 (2H, d, J = 8.49Hz, 1,4-disubstitutedbenzeneC-H),12.71(1H,s,Benzimidazole 1,4-disubstituted benzene C-H), 8.07 (2H, d, J = 8.55, 4-cyanophenyl C-H), 8.20 (2H, d, J = 8.55, 4-cyanophenyl -NH).13C-NMR(75MHz,DMSO-d6):𝛿(ppm):15.53,21.68, C-H), 8.31 (2H, d, J = 8.46Hz, 1,4-disubstituted benzene 21.81,36.24,41.22,114.96,115.51,115.96,124.43,127.26,128.50, C-H),12.96(1H,s,Benzimidazole-NH).13C-NMR(75MHz, 129.03, 129.24, 129.84, 130.84, 131.95, 132.24, 133.26, 144.78, DMSO-d6):𝛿(ppm):15.52,21.83,41.13,116.03,118.57,121.93, 150.42,150.58,154.78,193.21.[M+H]+calcdforC27H25N5OS: 123.66, 127.25, 128.42, 129.25, 129.54, 131.74, 132.03, 133.34, 468.1853;found:468.1856. 134.03, 137.00, 139.10, 142.84, 150.28, 150.43, 154.86, 193.40. [M+H]+calcdforC27H22N6OS:479.1649;found:479.1640. 2.1.20. 2-(4-(4-Ethyl-5-(2-(4-chlorophenyl)-2-oxo-ethylthio)- 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole 2.1.17. 2-(4-(4-Ethyl-5-(2-(4-fluorophenyl)-2-oxo-ethylthio)- (5o). Yield: 79%. M.p. 237-238∘C. FTIR (ATR, cm−1): 3045 4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzimidazole (N-H), 1695 (C=O), 847 (1,4-disubstituted benzene C-H). (5l). Yield: 78%. M.p. 241-242∘C. FTIR (ATR, cm−1): 3142 1H-NMR (300MHz, DMSO-d6): 𝛿 = 1.27 (3H, t, J = 7.10, 6 JournalofChemistry -CH3), 2.44 (3H, s, -CH3), 4.11 (2H, br.s, -CH2), 5.00 (2H, 2.44(3H,s,-CH3),4.11(2H,q,J =7.10Hz,-CH2),4.88(2H, s, -CH2-), 7.06 (1H, d, J = 8.01Hz, Benzimidazole C-H), s, -CH2-), 6.86 (1H, d, J = 8.25Hz, Dihydroxyphenyl C-H), 7.41 (1H, s, Benzimidazole C-H), 7.51 (1H, d, J = 6.87Hz, 7.05(1H,d,J =7.23Hz,BenzimidazoleC-H),7.35–7.55(4H, Benzimidazole C-H), 7.65 (2H, d, J = 8.62, 4-chlorophenyl m, Dihydroxyphenyl C-H, Benzimidazole C-H), 7.82 (2H, C-H), 7.82 (2H, d, J = 8.35Hz, 1,4-disubstituted benzene d, J = 8.40Hz, 1,4-disubstituted benzene C-H), 8.31 (2H, C-H),8.06(2H,d,J =8.62,4-chlorophenylC-H),8.31(2H, d, J = 8.40Hz, 1,4-disubstituted benzene C-H), 9.47 (1H, s, d, J = 8.35Hz, 1,4-disubstituted benzene C-H), 12.93 (1H, -OH),10.04(1H,s,-OH),12.92(1H,s,Benzimidazole-NH). s, Benzimidazole -NH). 13C-NMR (75MHz, DMSO-d6): 𝛿 13C-NMR(75MHz,DMSO-d6):𝛿(ppm):15.53,21.81,36.25, (ppm):15.52,21.81,40.80,41.08,115.03,124.41,124.60,127.24, 41.07,111.53,115.66,119.10,119.27,122.49,124.03,124.82,127.23, 127.54, 128.48, 129.25, 132.04, 132.83, 133.57, 144.63, 145.83, 128.43, 129.25, 129.43, 130.85, 131.10, 132.03, 132.27, 134.50, + 139.16,142.37,150.42,153.03,154.83,192.88.[M+H]+calcdfor 150.76,151.85,154.76,191.74.[M+H] calcdforC26H23N5O3S: 486.1594;found:486.1592. C26H22ClN5OS:488.1306;found:488.1304. 2.2. Antifungal Activity. The antifungal activity of synthe- 2.1.21. 2-(4-(4-Ethyl-5-(2-(2,4-dichlorophenyl)-2-oxo-ethyl- sized compounds 5a–5s against Candida species was per- thio)-4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzim- ∘ −1 formed according to EUCAST definitive method EDef 7.1 idazole(5p). Yield:75%.M.p.211-212 C.FTIR(ATR,cm ): [29]. Briefly, cultures of four fungi (C. glabrata (ATCC 2920 (N-H), 1670 (C=O), 864 (1,4-disubstituted benzene C-H). 1H-NMR (300MHz, DMSO-d6): 𝛿 = 1.25 (3H, t, 90030), C. krusei (ATCC 6258), C. parapsilosis (ATCC 22019),andC.albicans(ATCC24433))weregrowninRPMI J = 7.19, -CH3), 2.44 (3H, s, -CH3), 4.07 (2H, q, J = ∘ medium,afteranovernightincubationat37 C.Fungisuspen- 7.10Hz,-CH2),4.85(2H,s,-CH2-),7.04(1H,d,J =8.16Hz, sionwasadjustedtoapproximately0.5–2.5×105cfu/mLwith Benzimidazole C-H), 7.40 (2H, br.s, Benzimidazole C-H), RPMImedium.ThetestwascarriedoutformediumatpH 7.60 (1H, dd, J = 8.37Hz–1.98Hz Dichlorophenyl C-H), = 7 and twofold dilution was carried out in a 96-well plate 7.76 (1H, d, J = 1.92Hz, Dichlorophenyl C-H), 7.82 (2H, toobtaintheseriesdilutionswiththeconcentrationsranging d, J = 8.36Hz, 1,4-disubstituted benzene C-H), 7.89 (1H, from 0.78 to 800𝜇g/mL. The last well on the microplates, d, J = 8.40Hz, Dichlorophenyl C-H), 8.32 (2H, d, J = which was containing only the inoculated broth, was kept 8.36Hz, 1,4-disubstituted benzene C-H), 12.91 (1H, s, Benz- as control, and the last well with no growth of microor- imidazole -NH). 13C-NMR (75MHz, DMSO-d6): 𝛿 (ppm): ganism was recorded to represent the minimum inhibitory 15.46,21.81,43.05,111.51,119.19,120.61,122.55,124.00,127.24, concentration (MIC50) in𝜇g/mL. The 96-well plates were 128.05, 128.32, 129.25, 130.56, 131.98, 132.07, 132.11, 132.80, incubatedfor24h,and,attheendoftheincubation,resazurin + 135.82,137.27,142.48,150.22,154.89,194.94.[M+H] calcdfor (20𝜇g/mL) was added to each well to control the growth C26H21Cl2NOS:523.0917;found:523.0912. in the wells. Final plates including microorganism strains wereincubatedfor2h.MIC50valuesweredeterminedusing 2.1.22. 2-(4-(4-Ethyl-5-(2-(2,4-difluorophenyl)-2-oxo-ethyl- microplatereaderat590nmexcitationand560nmemission thio)-4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzim- ∘ −1 wavelengths;MIC50readingswereperformedtwiceforentire idazole(5o). Yield:73%.M.p.239-240 C.FTIR(ATR,cm ): compounds. Ketoconazole and fluconazole were used as 3045(N-H),1699(C=O),847(1,4-disubstitutedbenzeneC- controls. H).1H-NMR(300MHz,DMSO-d6):𝛿=1.28(3H,t,J=7.20, -CH3),2.44(3H,s,-CH3),4.11(2H,q,J=7.14Hz,-CH2),4.90 2.3. Quantification of Ergosterol Level. Total intracellular (2H, s, -CH2-), 7.06 (1H, d, J = 7.20Hz, Benzimidazole C- sterols were extracted as described previously[30]. Sabour- H),7.29(1H,td,J =8.44Hz–2.32Hz,DifluorophenylC-H), aud dextrose broth (50mL, Difco), enclosing 0, 0.78, 1.56, 7.41(1H,s,BenzimidazoleC-H),7.41–7.54(2H,m,Benzimi- and 3.125𝜇g/mL of compounds 5i, 5s, and positive con- dazole C-H, Difluorophenyl C-H), 7.83 (2H, d, J = 8.42Hz, trols were inoculated with a single C. albicans colony from 1,4-disubstituted benzene C-H), 7.99–8.07 (1H, m, Difluo- an overnight Sabouraud dextrose agar plate culture. After ∘ rophenyl C-H), 8.31 (2H, d, J = 8.42Hz, 1,4-disubstituted incubation for 16h at 35 C, the stationary-phase cells were 13 benzeneC-H),12.96(1H,s,Benzimidazole-NH). C-NMR separated by a centrifugation at 2,700rpm (Hettich, Rotina (75MHz, DMSO-d6): 𝛿 (ppm): 15.50, 21.81, 44.20, 44.30, 380R,Germany)for5min.Isolatedcellswerewashedwith 105.81(t,J=26.8Hz),113.04(dd,J=21.6Hz–3.6Hz),123.38, steriledistilledwater;alcoholicpotassiumhydroxidesolution 124.40, 127.05, 127.24, 128.42, 128.74 129.26, 132.02, 132.22, (25%, 3mL) was added to each pellet and vortexed for 133.37(dd,J =11.1Hz–3.6Hz),135.80,137.99,142.60,150.40, 1min.Cellsuspensionsinsterileborosilicateglasstubeswere ∘ 154.84, 163.09 (dd, J = 234.1Hz–11.7Hz), 165.86 (dd, J = incubatedinawaterbath(85 C)for1h.Aftercoolingtoroom + 255.0Hz–12.8Hz), 190.30 (d, J = 4.1Hz). [M+H] calcd for temperature,sterolswereextractedinthewater:chloroform C26H21F2N5OS:490.1505;found:490.1494. (1:3mL) mixture by a vigorous vortex mixing for 3min. Thechloroformlayerwasseparatedandsterolextract(1𝜇L) 2.1.23. 2-(4-(4-Ethyl-5-(2-(3,4-dihydroxyphenyl)-2-oxo-ethyl- was injected to LC-MSMS system (Shimadzu LCMS 8040, thio)-4H-1,2,4-triazol-3yl)-phenyl)-5(6)-methyl-1H-benzim- Kyoto, Japan). The mass spectrometric analysis conditions ∘ −1 idazole(5s). Yield:84%.M.p.252-253 C.FTIR(ATR,cm ): were provided as reported in our recent study [31]. Level 1 3300(N-H),1683(C=O),852(1,4-disubstitutedbenzen). H- of ergosterol in negative control samples was considered NMR(300MHz,DMSO-d6):𝛿=1.27(3H,t,J =7.17,-CH3), as 100%. All samples, including different concentrations of JournalofChemistry 7 compounds(5iand5s)andreferenceagents,wereanalyzed derivatives had coherent results with the theoretical values. inquadruplicate,andthedatawerestatedasmean±standard HRMS findings were in accordance with the theoretical deviation(SD). molecularformulaofthecompounds(5a–5s). 2.4.CytotoxicityTest. NIH/3T3mouseembryonicfibroblast 3.2.AntifungalActivity. Theinvitroantifungalscreeningfor cell line (ATCC CRL 1658) was used in the cytotoxicity all the synthesized compounds was evaluated against Can- test. The cells were incubated as reported in the supplier’s didaglabrata(ATCC90030),Candidakrusei(ATCC6258), guide.TheMTTassaywasappliedaccordingtoourprevious Candida parapsilosis (ATCC 22019), and Candida albicans studies [32–34]. The IC50 values of compounds 5i and 5s (ATCC24433)usingtwofoldserialdilutiontechniquerecom- were calculated from the plots of cell proliferation against mendedbyEUCASTdefinitive(EDef7.1)method[29]with concentrationsbyapplyingregressionanalysesonGraphPad thepositivecontrolofclinicalantifungaldrugsketoconazole PrismVersion5. and fluconazole. The MIC50 value of the compounds and controldrugsaresummarizedinTable1. 2.5. Prediction of ADME Parameters. Physicochemical pa- According to antifungal screening, most of the newly rametersofsynthesizedcompounds(5a–5s)werecalculated synthesizedcompoundscouldeffectivelyinhibitthegrowth byusingQikProp4.8.[35]. of all the tested fungal strains. All of the final compounds exhibitedmoderatetogoodantifungalactivitieswithMIC50 2.6.MolecularDocking. Astructurebasedinsilicoprocedure valuesrangingfrom12.5to0.78𝜇g/mL.Compounds5iand was applied to discover the binding modes of most active 5s, bearing 3,4-dihydroxyphenyl group, exerted the best compounds5iand5sto14alpha-steroldemethylaseenzyme activitiesininhibitingthegrowthofalltestedfungalstrains. activesites.Thecrystalstructureofenzyme(PDBID:1EA1) The microbiological results revealed that the antifungal [36], which was crystallized with the reference drug (flu- effectsofthecompoundsonCandidaspeciesdidnotdepend conazole)ofantifungalactivityassay,wasretrievedfromthe on N-4 position of triazole. The results show that general ProteinDataBankserver(http://www.pdb.org). structure of the synthesized compounds has an impact on The structure of ligand was built using the Schro¨dinger antifungalactivityandthiseffectisfurtherenhancedbythe Maestro[37]interfaceandthenwassubmittedtotheProtein 3,4-dihydroxystructure. Preparation Wizard protocol of the Schro¨dinger Suite 2016 Update 2 [38]. The ligands were prepared by the LigPrep 3.3.InhibitionofErgosterolBiosynthesis. Infectionscausedby 3.8 [39] to assign the protonation states at pH 7.4 ± 1.0 eukaryoticorganismslikefungusgenerallypresentmoredif- and the atom types, correctly. Bond orders were assigned ficulttreatmentproblemsthanthoseofbacterialinfections. andhydrogenatomswereaddedtothestructures.Thegrid There are relatively few antifungal drugs that can identify generation was formed using Glide 7.1 [40] program and unique targets not shared with human hosts. The fungal dockingrunswereperformedwithsingleprecisiondocking cell wall remains an underdeveloped therapeutic target for mode(SP). selective antifungal agents because of its chitin structure, which is absent in human cells [41, 42]. Most therapies are 3.ResultandDiscussion planned to treat fungal infections and target the ergosterol biosynthesispathwayoritsendproduct,ergosterol,amem- 3.1.Chemistry. Inthisstudy,wesynthesizedbenzimidazole- branesterolthatisuniquetofungi.Itisthemainsteroland triazolederivatives(5a–5s)infivesteps.Thesyntheticpathof thusisessentialforgrowthandnormalmembranefunction thetargetcompoundswasillustratedinScheme1. offungalcell.Besidesservingasabioregulatorofmembrane The structures of the new compounds (5a–5s) were fluidity, asymmetry, and integrity, it contributes to proper 1 13 confirmed by FT-IR, H NMR, C NMR spectroscopy, functionofmembrane-boundenzymes[43]. andmassspectra.Thespectroscopicinvestigationsofnewly The present work is a challenge to understand the synthesized compounds are accordance with the proposed probablemechanismofantifungalactivityofnewlysynthe- structure. The IR spectra of the benzimidazole-triazole sized benzimidazole-triazole hybrid compounds 5i and 5s. derivatives (5a–5s) exhibited N-H stretching absorption in Therefore,weanalyzedergosterollevelofC.albicansbyLC- −1 theregionof3305–2920cm andC=Ostretchingvibration MSMS studies. Total intracellular sterols were extracted as −1 intheregionof1699–1670cm .Theout-of-planebendingof reported by Breivik and Owades [30]. Ergosterol standard −1 1,4-disubstitutedbenzenewasassignedat864–843cm . (productnumber45480,Sigma-Aldrich,Germany)wasused 1 H NMR spectrum showed a broad singlet at for quantification of ergosterol in both inhibitor-free (neg- 13.32–12.11ppm due to NH proton of the benzimidazole ative control) and inhibitor including samples. The most ring.Thearomaticprotonsbelongingto4-substitutedphenyl active compounds 5i, 5s and reference drugs were used gave peaks at 8.02–7.82 and 8.31–8.39 as two doublets. at 0.78𝜇g/mL, 1.56𝜇g/mL, and 3.12𝜇g/mL concentrations. Benzimidazoleprotonswererecordedat7.04–7.67ppm. Ergosterolquantityinnegativecontrolsampleswasregarded 13 In the C NMR spectra carbon of C=O group was as100%.Allconcentrationswereanalyzedinquadruplicate, assigned at 190.30–194.94ppm. In the aromatic region, the andtheresultswereexpressedasmean±standarddeviation peaks were seen at estimated areas but the assignments (SD)[31](Figure2). could not be determined, clearly. Chemical shifting of the Ergosterol quantification studies indicated that com- substituted group and coupling constant of the fluorinated pounds 5i, 5s and reference agents significantly reduced 8 JournalofChemistry CHO .(2 + .;232/5/$-& (3# N O .(2.(2·(2//%N/( (3# .(2 MWI NH O MWI 1 O O (3# N O .( 21-N C S/EtOH (3# N O H 2 NH N NH NH Reflux NH NH R S 2 3a-3b R NaOH/EtOH (3# N N N R +2#/3/!=?NIH? + Reflux N N SH R Reflux H 4a-4b R Br O R ( # 3 N N N R R N N S H R O 5a–5s R:-C(3,-#2(5;R,R,R: -H, -Cl, -F, Br, CN, OH, C(3 Comp. R R R R 5a -C(3 -H -H -H 5b -C(3 -H -H -CN 5c -C(3 -H -H -F 5d -C(3 -H -H -Br 5e -C(3 -H -H -C(3 5f -C(3 -H -H -Cl 5g -C(3 -F -H -F 5h -C(3 -Cl -H -Cl 5i -C(3 -H -OH -OH 5j -#2(5 -H -H -H 5k -#2(5 -H -H -CN 5l -#2(5 -H -H -F 5m -#2(5 -H -H -Br 5n -#2(5 -H -H -C(3 5o -#2(5 -H -H -Cl 5p -#2(5 -F -H -F 5r -#2(5 -Cl -H -Cl 5s -#2(5 -H -OH -OH Scheme1:Synthesiswayforfinalcompounds. the level of ergosterol at all tested concentrations. Com- observedforcompound5satthesameconcentrations.Ref- pound 5i displayed 61.74%, 85.41%, and 93.71% inhibitions erencedrugsketoconazoleandfluconazoleindicatedsimilar at 0.78𝜇g/mL, 1.56𝜇g/mL, and 3.12𝜇g/mL concentrations, inhibition potencies to those of compounds 5i and 5s in respectively.Inhibitionsof62.05%,84.48%,and93.12%were the range of 63.71% to 94.46%. A concentration-dependent JournalofChemistry 9 Table1:MIC50(𝜇g/mL)valuesofcompounds5a–5s. Comp. C.albicans C.glabrata C.krusei C.parapsilosis 5a 12.5 6.25 6.25 12.5 5b 6.25 3.12 6.25 6.25 5c 12.5 6.25 6.25 12.5 5d 6.25 12.5 6.25 6.25 5e 12.5 6.25 12.5 12.5 5f 6.25 3.12 3.12 6.25 5g 3.12 6.25 6.25 6.25 5h 12.5 6.25 12.5 6.25 5i 0.78 1.56 1.56 0.78 5j 12.5 6.25 12.5 12.5 5k 12.5 6.25 12.5 12.5 5l 6.25 12.5 6.25 12.5 5m 3.12 3.12 3.12 6.25 5n 3.12 3.12 1.56 3.12 5o 3.12 3.12 6.25 6.25 5p 12.5 12.5 6.25 6.25 5r 6.25 3.12 3.12 3.12 5s 0.78 1.56 1.56 0.78 Ketoconazole 0.78 1.56 1.56 1.56 Fluconazole 0.78 1.56 1.56 0.78 100 Table 2: CC50 (NIH/3T3), MIC50 (C. albicans), and SI results of 90 selectedcompounds. 80 Comp. CC50(𝜇g/mL) MIC50(𝜇g/mL) SI 70 5i 86.59 0.78 111.01 60 5s 138.85 0.78 178.01 L RE 50 % 40 design and/or selection of improved drug candidates that 30 have more possibilities of becoming commercialized drugs 20 [44]. Therefore, we used the MTT cell viability assay to determinecytotoxicityofthemostactivecompounds5iand 10 5s against NIH/3T3 mouse embryonic fibroblast cell lines 0 (ATCCCRL1658),whichisrecommendedbyISO(10993-5, 0.78 1.56 3.12 (g/mL) 2009)[45].Cytotoxicconcentrations(CC)oftestcompounds are presented as CC50 values in Table2. Compounds 5i Negative control Fluconazole and 5s displayed CC50 of 86.59𝜇g/mL and 138.85𝜇g/mL, Compound 5i Ketoconazole respectively.Inordertoevaluateselectivityprofilesofcom- Compound 5s pounds, selectivity indexes (SIs) were expressed as CC50 Figure2:RelativeergosterollevelofC.albicansaftertreatmentof (NIH/3T3)/MIC50 (C.albicans).Siswerecalculatedas111.01 synthesizedcompoundsandreferenceagents. and 178.01 for compounds 5i and 5s, respectively. These findings display that the anticandidal activity of the com- pounds 5i and 5s is not related to general toxicity but can decreaseintheergosterollevelwasestablishedforalltested beascribedtotheirselectiveactionagainstCandidaspecies. agents.Hence,itcanbeobviouslysuggestedthatcompounds Thus,cytotoxicitytestfindingsenhancedtheimportanceof 5iand5shavearoleintheergosterolbiosynthesispathway. compounds5iand5sasanticandidaldrugcandidates. 3.4. Cytotoxicity Test. Toxicity is the main reason for the 3.5.TheoreticalCalculationofADMEParameters. Highbio- failure at all stages of the new drug development process. logical activity and low toxicological effects are not enough Themajorpartofsafety-relatedattritionoccursatpreclinical foracompoundtobecomeadrugcandidate.Agoodphar- phases while predicting preclinical safety liabilities earlier macokineticsprofileisalsoveryimportantforthenewdrug in the drug development process. This strategy enables the candidates that should be evaluated earlier in the process 10 JournalofChemistry Table3:CalculatedADMEparametersofcompounds5a–5s. Comp. MW RB MV DHB AHB PSA log𝑃 log𝑆 PCaco PM VRT VRF 5a 439.53 4 1372.27 1 5.5 83.23 5.43 −7.86 754.43 2 1 1 5b 464.54 5 1438.97 1 7 109.02 4.66 −8.79 156.01 2 0 1 5c 457.52 4 1388.38 1 5.5 83.23 5.67 −8.22 754.33 2 1 1 5d 518.43 4 1425.30 1 5.5 83.23 6.00 −8.72 754.38 2 2 1 5e 453.56 4 1431.21 1 5.5 83.23 5.74 −8.42 754.43 3 1 1 5f 473.97 4 1416.39 1 5.5 83.23 5.93 −8.60 754.37 2 1 1 5g 508.42 4 1465.01 1 5.5 80.43 6.39 −9.33 740.09 2 2 1 5h 475.51 4 1410.99 1 5.5 82.91 5.86 −8.58 643.17 2 1 1 5i 471.53 6 1400.25 3 7 128.41 3.79 −6.86 74.95 4 0 1 5j 453.56 5 1412.00 1 5.5 82.77 5.62 −7.82 676.16 2 1 1 5k 478.57 6 1478.70 1 7 108.56 4.85 −8.75 139.83 2 0 1 5l 471.55 5 1428.11 1 5.5 82.77 5.86 −8.18 676.08 2 1 1 5m 532.46 5 1465.03 1 5.5 82.77 6.19 −8.68 676.13 2 2 1 5n 467.59 5 1470.94 1 5.5 82.77 5.93 −8.38 676.16 3 1 1 5o 488.01 5 1456.12 1 5.5 82.77 6.12 −8.56 676.11 2 1 1 5p 522.45 5 1414.92 1 5.5 74.59 6.17 −7.94 1124.54 2 2 1 5r 489.54 5 1449.32 1 5.5 80.90 6.09 −8.56 712.34 2 1 1 5s 485.56 7 1412.81 3 7 124.13 3.93 −6.33 98.80 4 0 1 MW:MolecularweightRB:NumberofrotatablebondsMV:Totalsolvent-accessiblevolumeDHB:EstimatednumberofhydrogenbonddonorsAHB:Estimated numberofhydrogenbondacceptorsPSA:VanderWaalssurfaceareaofpolarnitrogenandoxygenatomsandcarbonylcarbonatomslog𝑃:Predicted octanol/waterpartitioncoefficientlog𝑆:PredictedaqueoussolubilityPCaco:PredictedapparentCaco-2cellpermeabilitylog𝐵𝐵:Predictedbrain/blood partitioncoefficientPM:NumberoflikelymetabolicreactionsVRF:NumberofviolationsofLipinski’sruleoffive.Therulesare:MW<500,log𝑃<5,DHB ≤5,AHB≤10,PositivePSAvalueVRT:NumberofviolationsofJorgensen’sruleofthree.Thethreerulesare:log𝑆>−5.7,PCaco>22nm/s,PM<7. of drug development. Thus, it has become important to 3.6.MolecularDocking. Dockingstudieswereperformedin examine the ADME profiles of pharmaceuticals as early as order to gain more insight into the binding mode of the possibleinthedrugdiscoveryprocesstoreducetheamount compounds 5i and 5s to lanosterol 14-𝛼-demethylase. Due ofwastedtimeandresources.Moreover,insilicoprediction to the fact that lanosterol 14-𝛼-demethylase is membrane- of ADME can be used to identify individual molecules or bound enzyme, its crystallization from the Candida species chemicallibrariesbyevaluatingtheirsuitabilityaspotential isdifficultforX-rayanalysisanddockingstudies.Thus,there drug molecules. The determination of the attempted lead is no experimental data or crystal structure of this enzyme in Protein Data Bank server. On the other hand, lanosterol optimizationbeforesynthesizingthecompoundscausesless 14-𝛼-demethylasefromMycobacteriumtuberculosishashigh redesign-synthesize-test cycles [46]. Thus, predictions of homologytothatoflanosterol14-𝛼-demethylasefromCan- ADMEpropertiesoftheallsynthesizedcompounds(5a–5s) didaspecies.Ithasbeenreportedthatthesetwoenzymeshave wereperformedbyQikProp4.8software[35].Thissoftware high degree of similarity between the hydrophobic cavities applies Lipinski’s rule of five [47] and Jorgensen’s rule of ofthecatalyticsite[49,50].Therefore,dockingstudieswere three [48], which evaluate the ADME properties of new carried out using X-ray crystal structure of lanosterol 14- drug candidates and are essential for the optimization of 𝛼-demethylasefromMycobacteriumtuberculosisincomplex a biologically active compound. Molecular weight (MW), withfluconazole(PDBID:1EA1)[36]obtainedfromProtein number of rotatable bonds (RB), molecular volume (MV), DataBankserver(http://www.pdb.org). number of hydrogen donors (DHB), number of hydrogen Asstatedinantifungalactivitysection,compounds5iand acceptors (AHB), polar surface area (PSA), octanol/water 5s were found to be the most active derivatives against C. partitioncoefficient(log𝑃),aqueoussolubility(log𝑆),appar- krusei,C.albicans,C.parapsilosis,andC.glabrata with0.78, ent Caco-2 cell permeability (PCaco), number of likely 1.56, 1.56, and 0.78𝜇g/mL MIC values, respectively. Thus, primer metabolic reactions (PM), and percent of human the main purpose of docking studies was to investigate the oral absorption (% HOA) are presented in Table3 along possibleinteractionofthesecompoundswithlanosterol14- with the violations of rules of three (VRT) and five (VRF). 𝛼-demethylaseenzyme. According to Lipinski’s rule of five and Jorgensen’s rule of Thetwo-dimensional(Figures3(a)and4(a))andthree- three,compounds5iand5sareinaccordancewiththeruleby dimensional(Figures3(b)and4(b))posesofthecompounds causingnomorethanoneviolation.Thus,itcanbesuggested 5iand5sarepresentedinFigures3and4.Thedockingposes thatthemostactiveanticandidalcompounds5iand5smay onlanosterol14-𝛼-demethylaserevealsthattheinteractions possess a good pharmacokinetic profile, increasing their betweenthecompounds5i,5sandHEM450areveryimpor- pharmacologicalimportance. tantintermsofbindingtoactivesiteofenzyme.Totallythere

Description:
3Doping and Narcotic Compounds Analysis Laboratory, Faculty of Pharmacy, Anadolu University, 26470 Eskisehir, Turkey MW: Molecular weight RB: Number of rotatable bonds MV: Total solvent-accessible volume DHB: Estimated number of hydrogen bond donors AHB: Estimated number of
See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.