Who Has Time For Banking? Let's face it. With so many demands on your busy schedule, you may not have time to give your finances the attention they deserve. That's where we can help. We're Professional & Executive Banking at NationsBank. And while we can't turn your crammed daily calendar into empty pages, we can take the hassle out ofbanking. You'll work with one ofour experienced bankers, who will meet with you at your convenience and personally assist you with your finances. Whether your banking needs concern loans, savings orjust a checking account, we'll help you decide what's right for you and put your plans into action. Discover the convenience of Professional & Executive Banking. Call Mary Hill Gary at (706) 849-0667 or Jean P Daniel at (706) 729-9156. Because while you may not have time for banking, we do. NationsBank NationsBankCorporationsubsidiaryhanksarcmembersFDIC {=)Ei/ualHousingLenders it 1997NationsBankCorporation visitusatwww.nationsbank.com rheMedical Collegeof Georgiahas had many 2 AtaGlance high pointsduring its Asthmascreenings, helpforhighly stressedmothers andnipping eating disorders in 170-yearhistory,but thebud arejust afewofthepediatric initiatives atthe MedicalCollege ofGeorgia seldom hasthe university Children's Medical Center. had morecause tocelebrate than now. Thisfall, MCG will fulfillone 41 Technologyand TLC ofits loftiestgoals andgreatest The new MedicalCollegeofGeorgiaChildren's Medical Centercombines dreams: theopening ofthe new technology and tenderlovingcare tocreate asecond-to-none healingenvironment Medical CollegeofGeorgia forchildren. Children's Medical Center. Thenew Children's Medical 71 CircleofChildren Centeris featuredin thiseditionof In herrolesasCMC Administratorand mom toT.J., Elizabeth Ostric is surrounded MedicalCollegeofGeorgia Today. bychildren. She wouldn'thave itany otherway. The facility has been inthe planning stagesforyears, andnodetail has 101 ThumbsUp beenoverlooked. Healthcarepro- When 12-year-oldJoshChance'sthumb wasripped offinatractoraccident. MCG's fessionals,community members, reattachment team sprang intoactionto make him whole again. parents andchildren have all pro- vided inputtocreate a facility that is 131 FitforaKid family-centered fromtheground up. MCG researchers are helpingyoung teens make lifestylechanges thatcan paydivi- We invite youtoreadall aboutthe dends forlife. Children's Medical Centerinthis edition ofthemagazine. 141 TheGiftofSight — In addition toreadingaboutthe Phillip Hunter'seye diseasethreatened todoom himtoalifeofdarkness until the CMC nutsandboltsofthe facility itself, stepped in. we inviteyou tobecome acquainted 177AlumNews with someofthepeople involved. Read, forinstance, about MCG's News from the five alumni associations. work helping teenslearn now how to headoffheartdisease downthe 371 Plan YourGiving road. Readalsoaboutachild whose Giftsofreal estate tothe Medical College ofGeorgia. sightwas savedby MCG ophthal- mologists, andaboutthe remarkable effortsofMCG'sreattachment MCGPresident: FrancisJ.Tedesco,M.D Editor: ChristineHurleyDeriso ExecutiveEditor: JamesB.Osborne.Ed.D. ArtDirector: BrentD.Burch team. DirectorofMarketingandPublicRelations: Photographer: PhilJones Thesearticles,ofcourse, only DaleCrail skimthe surfaceofthe many ©1998.MedicalCollegeofGeorgia.TheMedicalCollegeofGeorgiaisthehealthsciencesuniversityofthe achievementsthatunfoldday in and UniversitySystemofGeorgia.Focusingonhealth-careeducation,researchandpatientcare,theAugusta-based dayoutattheMCGChildren's institutionconsistsofMCGHospital,morethan80supportclinics,statewideoutreachprogramsandtheSchools MedicalCenter. We thinktheCMC ofAMleldiiedcaHleaClotlhleSgceieonfceGse,orDgeintaisTtordy.ayGrisadsupaotnesoSrteuddibeys.gMreandtiscifnreomanMdCNGursFionugn.dation,Inc.andtheMCGSchoolof is oneofthebrightest gems inthe MedicineAlumniAssociation.ItisproducedbytheDivisionsofInstitutionalRelationsandHealthCommunication; estdaitteioonfoGfeotrhgeimaa.gAafztienre,rewaedihngoptehis AfMuuergdnuiiscsathlaedMCaotolglaaezlgiuenmeno,ifG(ae7no0d6r)gfri7iae2;n2dA-su5go8uf3s3Mt,aC,PG.GOew.oirtBghoioxaut31c04h90a15r2,g.eA.uAgdTvuheserttaai.pspiGeneagorraignnicqaueir3oi0fe9as0d3sv.heorPutulibdsleibmseehndetidsreqicuntatrehtdiestrolpyuM,bilMikceCatGDiooTnwonddeoaesysaintsot you'll agree. constituteanendorsementbytheMedicalCollegeofGeorgiaoftheproductsorservicesadvertised. o glance ot Breathing Easier A Helping Hand edical College ofGeorgiaresearchers wanttoalert The MCG Children's Medical Centeris matchinghighly parentsand teachers thatphysical inactivity inchil- stressednew mothers with volunteerstohelpthem may sIidgrnaelnamsatyhmsau.ggest more than adistaste forexercise. It TthheroCuMghCthFeiirrstdiSftfeicpusltpireso.gram wasdevelopedby the MCG nurses and respiratorytherapists recently screened GeorgiaCouncil on ChildAbuse and isfundedbythe 176 students at RichmondCounty's Hornsby Elementary Children'sTrust Fund. Poverty, youth, inexperience, adif- School forbreathing problems. "Thirty-twopercentof ficult pregnancy and/ora sick newborn are some stressors MCG those testedhad possible breathing problems," saidnurse thatcan hindereffectiveparenting, says clinical practitionerVirginia Kemp. "A scary thing is that 80per- nurse specialistCheryl D. Piatt. First Steps identifies these centofthose were not identifiedin the school as having highly stressed mothers, ideally before theygivebirth, and breathingproblems." pairsthem with amentorwell-versed inchild-rearing. "We Thosechildren often simply avoid physicalexertion are providingemotionalcare tomoms by havingthe volun- ratherthandraw attention totheirlimitations, the teers go intotheirhomes," says First StepsCoordinator researchers said. Buttheiravoidanceofthe problemcomes AliceJohnson. "Wearetrainingourmomsby helping them atacost. "Studies suggestthat ifyoudon'ttreatasthma gettoknow themselvesand theirchildren." early, itcan become chronic." saidrespiratory therapist Randy Baker. "Withearly intervention andpropertreat- ment, you may decrease long-term problems." Making the Grade The researchers hopetoexpandtheirscreening andedu- Dr. William cational efforts, identifying children with breathing prob- CMC teacherTracy Kormylomakes sure that B. Strong, lems. As wasthecase with the Hornsby students, parents hospitalized and/orchronically ill children Chiefof then wouldbe urged tocontact theirpediatricianorwould keep uptheirschoolwork. In apilotpro- Pediatric receive referrals upon request totreat the problem. gram, oneCMCpatient"attends" herregular Cardiology, with patient Eating-Disorders Alert 1 Dentists may bethe first lineofdefense in puttingthe brakes oneating disorders. Swollen salivary glands, downy facial hairandanacidic residue in the mouth — can signal bulimiaoranorexia anddentists areoftenthe firsttospot the problem. "Primarily the acidcausesdamage which leadstodeteriorationofenamel," says Dr. James MCG Curtis, Assistant ProfessorofOral Rehabilitation. When he suspects bulimia, hegently inquires abouthis patient'seating habits. "It'simportanttobe sensitive and non-judgmental," he says. "Mostpatientsdeny they arebulimic, butatleastthe idea is planted that someone suspects something is wrong." Knowledge isessential inrecognizing indicationsofthe disease,he says. "The idea," Dr. Curtis said, "is totreatthe wholepatient and notjustthe dental problems." Patientsdiagnosed with aneatingdisordercanbe referredto specialists in thefield. Dr. Christian Lemmon directsMCG'sEating Disorders Program, tacklingthe — problematevery level includingtheemotional issuesthat triggeredthe problem. 2 MEDICALCOLLEGEOFGEORGIATODAY class,even when hospitalizedorhomebound, using televi- sion-based videoconferencing. No matterwherethe patient is, shecan maintaincontact with both Ms. Kormyloandher CMC middle school teacher. Sucheffortsensure that patients learn theirschoolworkand maintain asnormal livesas possible,even in the midst ofmedical treatment. What's for Lunch? Ifyouaskyourchild what he had forlunch in his school MCG I cafeteria, his answermightbe less than reliable. I Associate ProfessorofNutrition Suzi Domel Baxternotes thatchildren's self-reportsoftheirdietsare farfrom inac- curate:just becauseJohnny says heate hiscarrots, inother words,don'tcounton it. Such misleading informationcan skew researchthat links nutrition andhealth. Dr. Baxter observedchildreneating lunch in elementary schools, then interviewedthem attimedintervals afterward about what theyateand how muchthey liked it. She foundthatthe accuracyofthechildren's self-reportsdecreasedas the time interval lengthened. Herresearch alsoenabledhertoobservebehaviorsby teachers andschool aidesthat might negatively impactchil- dren's foodpreferences. "Inordertohelpchildren eatmore healthfully," she said, "we needtoassess whattheyare eating." A Team Effort CG is takingateamapproach totreating spasticity,a I commonandpotentially disablingchange in muscle tone. Commoncausesofspasticity inchildren I includecerebral palsy, strokes andhead injuries. Centralized,comprehensivecare is importantformaxi- mizingtreatmentanddevelopingcenterstocompiledatato MCG measuretheeffectivenessoftreatments, said neuro- surgeonJohn Vender. "Thegoal ofthisnew service," he said, "istoreduce spasticity and spasms and improve qual- ity oflife."Theteam includes neurologists, neurosurgeons, occupational therapists, physicaltherapists, social workers andcounselors whoworktodetermine theoptimal treat- mentplan, which may include medication, surgery orboth. CMC patient Grayson Diabetes Screening Wyattwith Bedside Tool mom Pam CMC A The is participating inastudy toidentify testthatcanbeusedatthebedside ofacritically ill those—atriskforType One insulin-dependentdia- childtomeasurebloodflow velocity in thebrain may betes then helpthem prevent it. The study screens helpdeterminethechild'schanceofsurvival. diabetics' first-degree relatives forislet cell antibodies, an MCG researcherscoordinateda six-yearstudy using early indicatorofthe disease, in which the pancreas's transcranial Doppler, a non-invasive test using sound waves inability toproduce insulinefficientlycanwage waron tomeasurebrain blood flow, toexamine 206children with organsthroughoutthe body. asevere brain injury. In 81 ofthe children, doctors identi- Ifantibodiesare found, participantsgetafollow-uptest, fiedtwoabnormal blood flow patterns thatappeartobe thenenteraprevention program ifthey are foundtohave excellent predictorsofwhetherachild will surviveorsig- markersforthe—disease. The program isdesigned todeter- nificantly recoverfromhisbrain injury. mine ifins—ulin knowntobe alifesaveroncethedisease is "Ifthis finding isconfirmed in a largerstudy, thenwe diagnosed can halt the disease'sdevelopment. "Ifyou have abedsidetool wecanuseto serially monitorthese don't yet havediabetes, but dohave markers that you might children," said MCG pediatric intensivist EdwardJ. develop it, thebody'sexposure to insulin appearsto protect Truemper. the pancreas sothe immune system won'ttarget it forfur- therdestruction," saidpediatric endocrinologist WilliamH. Hoffman. VOLUME26, NUMBER 3/SPRING 1998 3 MCGAmbulatoryCareCenter MCGFacultyOfficeBuilding MCGAmbulatoryCareCenter ParkingDeck FIRST FLOOR R Restrooms E PublicElevator Reception I WelcomeCenter Telephone by Sally Simkins lotaday goesbythat couldnothave plannedabetterplace for Design AwardsCompetition sponsored Elizabeth Ostric does- children, she said. by Modern Healthcare magazine and the n't walkordrivedown The new MCGChildren's Medical American InstituteofArchitects' ^/ HarperStreet. It's not Centeravoidsthe tendency totreat space Academy ofArchitecture forHealth. The Q necessaryforhertogo forchildren with aconventional play- awards recognizeexcellence in designing thatway togettowork in the morningsor house mentality, according tojudges who and planning new and remodeled health go home at night. It's the scenery that selected it awinner in the 12th annual care facilities. drawsherthere: theconstruction siteof the new MedicalCollegeofGeorgia Children's Medical Center. MCG Ambulatory "When I see it, I am inawe," Ms. CareCente CMC Ostric, Administrator, saidof Neuro- the newCMC, which will bededicated pOsfyfcihcoelaongdy May I. Ms. Ostric wasn't in Augusta ClinicalSpace when ground wasbrokenforthe new ToMCG•«H-ospital PsychiCahitlrdy Faculty hospital in November 1995. At the time, Offices she wasavicepresidentatLeBonheur Children's Medical Centerin Memphis, Tenn. Shecame to MCG in spring 1996, five monthsafterseveral young patients helpedturnthe soil with theceremonial ground-breaking shovels. SuppCoorntneScetrovircteos FLOOR "Thebuilding'scharacterand person- aMlCitGy,arewonrokwinegmewrigthinCg,M"CMsf.amOislitersi,ccsaoimd-. SeatingArea QTelepho munity members, architects andbuilders, 4 MEDICALCOLLEGEOFGEORGIATODAY — ronments forchildren andtheirfamilies. MCG The natureand technologyexperience is Ambulatory J CareCenter I* nh Id progressive throughout the facility, from 1 theentry plaza's natural arborwhere fruit ToMCGHospital PRreecoopvaenrdyRPhoaosmesII trees will provide asymbol oflife, tothe SurgeryandOutpatientProcedures lobby where nature and technology are l!E_TlSteravaiarustmoars ELleSvBtaaaftcfokrsRdeocoorvPehrayseRPoIeodimastric cteocmhbnionloegdicianlaavribdoerowahqeuraerithuemsainghdtstoatnhde Pharmacy toPICU IntensiveCare sounds ofnature will provide an intrigu- (PICU) Lab ing and imaginative pathway todiagnos- . , tic and treatment areas. The videoaquarium iscomprisedofa large grouping ofvideomonitors that will Endoscopy/Special ProceduresRooms FLOOR project asingle imageofan aquarium showcasing anexotic underseaworld. T H R D I Dolphins, whales, seahorses and other R Restrooms E Elevator Reception SeatingArea Telepho ocean life willbe featured, whileocean sounds will be heard in adjoining waiting "This projecttransmitsexuberance they stuckthe needle in. Thecolored areas. andexcitement," saidjudge Merlin rooms would make it better." A warmlycolored fossil flooring in MCG the lobby will lead tothe receptionarea; Lickhalter. "Thisisareal designatthe Paul saidthe Children's rightscale in which technology andten- Medical Centeris a lotdifferent from several largedinosaurfossils will be derlovingcare seemtocometogether otherhospitalshe's seen. The designof etched intothe walls, showing them lumberingdown thecorridortowardthe naturally." the facility focuseson nature and technol- Judge FrankGrauman saidthe facili- ogy, integratinghealthcare, education Family Resource Library. tayn'dsfdaemsiilgynssphaocwes—"reexaclelplleancceesfinorpapteioepnlte andentertainmenttocreate healingenvi- patThhweaytetcohanlilcatlreaartbmoerntwialrleamsarinktthheefive- tospendtime andspendit well." JudgeWilliam Powandacalledit MCG Ambulatory a superbarchitectural achievement CareCenter respondingtothe needsand interestsof patients. And well itshould. Patientsandtheir ToMCGHospital families helpeddesign it. They said what ETlervaautmoars [treatment —1 StafT they wanted, andthe architectural firm Stairs Room "Elevators Stanley, Beaman and SearsofAtlanta Confer- Treat- ence ment incorporatedtheirideas intotheirplans. Room Room "They made averyconcertedeffort tobe sure thatthe hospital wouldbe I Consult orientedtoward the patientsand <itAir«; '- families," said RogerLeDuc ofAiken, FOURTH FLOOR S. C,whose 13-year-oldson, Paul,has CMC been a patientoverthe years. "They evenhad ushelptry out the furniture to R Restrooms E Elevator SeatingArea | |NursesStation j |PatientRooms Telephone be sure itwascomfortable, knowing that parents wouldbetheones sitting forlong periodsoftime. "They talked with kids from5 years oldtotheirmid-teenstofindoutwhat matterstothem," Mr. LeDuc said. His son,Paul, servesontheChildren's AdvisoryCouncil—KidsART(Archi- — tectural and RecreationalTeam) which helpeddeveloptheCMC. "We all gave suggestions,"he said. "I suggestedthat they have fruit salads with lunchanddin- ner, withthings like pineappleand kiwi thingsthataregood foryou. "I also suggestedthatthey paint the wallsdifferentcolors intheexam rooms," FIFTH FLOOR hecontinued. "Haveone speckled room, apinroatthese.rWpohleknadIowtaasnda lainttoltehkeird,onIediwdint'ht R Restrooms E Elevator '. SeatingArea NursesStation PatientRooms Telephone like togetbloodtests. Itwouldhurt when VOLUME26, NUMBER 3/SPRING 1998 storybuilding. A seriesofvideototems informationforyoung people throughthe attheCMC toexaminepatients inclinics will appearthroughout—thearbortodis- MCGGeorgiaInstituteforthe Prevention andhospitals hundredsofmilesaway play images ofnature waterfalls,rain ofHumanDiseaseand Accidents. And, and, muchofthetime,eliminate the need forests, gardens andmountains. Sounds insteadofchildren andfamilies from forfamiliestotravel. ofnature will be heardalongthepath. throughoutGeorgiaalwaystravelingto Asaclinical facilityofGeorgia's The interiordesign isagreentheme; theCMC in Augusta, healthcare health sciencesuniversity, MCG technological tree canopiesconstructedof providersattheCMC travel regularly to Children's MedicalCenterisadynamic computercircuit boards accenttheentries satelliteclinics in theGeorgiacitiesof teachingenvironmentwherethe most ofeachdepartment. Waycross, Brunswick, Savannah, current approachestohealthcareare Toencourageparentstoremain Valdosta, Columbus, WarnerRobins, practiced, taught and, often, discovered. actively involved in theirchild'scare,as Macon, Athens, Moultrie,Thomasville, Dr. WilliamP. KantoJr., Chairmanof well as fortheircomfort, all roomswill Fitzgerald. Albany and Dublin. the DepartmentofPediatrics and Medical have trundlebeds forfamily use. There Technology alsocan reducethe need DirectoroftheCMC, saidtheCMC alsowill be family lounges withcomfort- forfamiliestotravel forhealthcare. The intendstobeoneofthe top 10children's able seating in aliving-roomatmosphere, MCGTelemedicineCenterandthe medicalcenters in the country. "We will kitchenettesand laundry facilities. The GeorgiaStatewideTelemedicineProgram dothisby providingthe finest technical Pediatric Intensive Care Unitwill have usehigh-resolution videocameras and care inacompassionate, family-centered roomforparents to stay neartheirchil- computers linked togetherviaaspecial environment,"he said. dren around theclock. Anoutdoorroof groupingoftelephone lines andfiber- garden on the fourth floorwill offer opticcablestoenabledoctors patientsand family members apeaceful diversion. PatriciaSodomka, Executive Director MCG of Hospital andClinics, sees the facility as asourceofhope and strength, a place where families know they can feel You are cordially invited veryconfident that are going toget the bestcare. new "When achild is ill, it is stressful for dedication of the the whole family." Ms. Sodomkasaid. to the "We want familiesto feel like this is their place. It's meant forthem." Georgia Andthe wholecommunity will be College of Medical involvedand represented, she noted. Community physicians, many ofwhom will serve asCMC partners, "are in many Medical Center wayskey toourultimate success," Ms. Children's Sodomka said. ThenewCMC will haveitsownemer- gency room andpediatric traumacenter, operating rooms, laboratories, radiology Harper Street * suite, admissionsprocessandparking. Its proximity toMCG'sotherclinical facili- tieswill allow ittocontinuetomake use 10 a.m. ofthose vastresourcesaswell. The 220,000-square-foot hospital will replaceexisting inpatientpediatric facilities locatedprimarily on theeighth May 1.1998 MCG floorof Hospital andwill beeasily V M accessible fromthe pediatric outpatient MCG facilitieson the thirdfloorofthe AmbulatoryCareCenter. It will increase SPEAKER from 111 to 149 the numberofbeds KEYNOTE dedicatedtothecareofsickandinjured children. The servicesofthe MCGChildren's The Honorable Zell Miller Medical Centeraren't limitedtothe facil- MCG ity in Augusta. doctorstaketheir Georgia prevention message intoGeorgia'sclass- Governor of rooms, givingchildren, teen-agers and theirparents the information they needto livehealthierlives. Some visits are in person, others viathe state'sdistance- learning network. TheCMC also isgenerating wellness 6 MEDICALCOLLEGEOFGEORGIATODAY by CaroleJ. Smith Children encircle Elizabeth — Ostric's life profession- ally, as Administratorofthe Medical Collegeof Georgia'sChildren Medical Center, and personally, as mothertoher 2-year-oldson,T.J. "I don't have any disconnections in my lifebetween where my heart is with children and what I do formy living," said Ms. Ostric. "I'm very fortunate becausemostpeopledon'tgettohave that in theirwork." A nativeofNew Bedford, Mass., Ms. Ostric receivedherbachelorofarts degree with adouble majorinbiochem- istryandhistory from SmithCollege and hermasterofhealth administration and planningdegreefromWashington University School ofMedicine. Followingan administrativeresidency atLeBonheurChildren's Medical Center in Memphis,Tenn., shejoinedLe Bonheur's staffand workedin various capacities including Directorof AdmissionsandTelecommunications, people, given theopportunity, will create, succeed andexcel betterasagroupthan any oneperson's visioncouldhave suc- ceeded inbuilding a wonderful CMC," Ms. Ostric said. Dr. Kantobelieves Ms. Ostric'senthu- siasm, vision andexperiencehave been a valuablecatalyst in thedevelopmentof theCMC. "She possesses aunique blend ofthe understanding andvision necessary toprovide leadershiptoachildren's med- ical centerthat ishousedwithin an acade- mic health sciencecenter, which must alsoberesponsivetothecommunity," saidDr. Kanto. Ms. Ostricbelievesthatwithin five yearstheCMC will be well on its wayto fulfilling the visionoffamily-centered careby serving as manychildren, from infants to youngadults, and families as possible. "Ithink people will comehere who aredesperately ill, but I thinkpeople will alsouseourhospital asahealth resource toboost the healthofthemselvesand theirfamilies," said Ms. Ostric. "Because ofthe people whoare involved, whether it'sthe Children'sAdvisoryCouncil,the Family AdvisoryCouncil, the medical stafforthe volunteers, I thinkyougeta senseofthe factthat we'rebuilding something that's unique and special." She alsonoted the invaluablecontributionof Memphis." community physicians, whoareforming During MCG partnerships with toensure thatthe herinterview Children's Medical Centerreachesoutto process, Ms. theentirecommunity andbeyond. Ostric was impressed Ms. Ostric's move totheCMCcoin- theCbMyCthefrcoommmtihetmceonmtmuto- coifdaendo,tihreorniocfalhleyr,gwoiatlhs:thmeotmahteerrhioaoldiz.atFioorn nity, the staffand family mem- three years, Ms. Ostric waitedonalistto bers likeJulie Moretz, whose son, becomean adoptive parent. Twenty-four Daniel, was born with congenital heart hours before she sold herhouse in defects andtreatedatthe CMC. MCG's Memphistorelocate to Augusta, her reputation as an outstandingacademic social workernotified herthat a6-month- AssistantVice PresidentofFinance and institution was anotherattraction. oldboy wasavailabl—e. jVoiicneinPgreMsiCdGentinof19O9p6e,raMtsio.nsO.stBriecfowraes pro"gIrahmasdthheaatrdMCfrGomgpreaodpulaeteidnstoramienionfg GerUbepronbasbeye—ingheTr.Jh.eartthweaismacagpetiovfattehde. Vice PresidentofProgram Development thebestpediatricians in thecountry," said "Itwasoneofthose things," said Ms. ofLe BonheurHealth Systems, Inc. Ms. Ostric. "I didn't want tomiss being Ostric. "I havetwothings that I've 12yLeeaarvs,inbgutTetnheneospspeoertwunaistydiftfoibcueltaacfhtielr- partMosf.sSuocdhoamhkiaghb-eqluiaelvietsyMinCstGituwtaiosn.f"or- atolwbaeytshewaandtmeindistotrdaot.orI'ovfeaalchwialydsrewna'nsted dren's medicalcenteradministrator, one tunate toattract Ms. Ostric. hospital, and I've always wantedtobea ofherlifelonggoals, luredherto "Elizabeth is averycreative,ener- mom. Sothefactthey both happenedthe Georgia. MCG administrators,faculty getic, visionary leaderwhobringsjustthe same week wasjustan overwhelming and staffalso influenced herdecisionto right touch forboth familiesand theirlit- opportunity." relocate. tleones, as well asfacilitatingthecollec- Now 2,T.J. is"smartasawhip" "Pat [Sodomka, Executive Directorof tiveworkofthe faculty, the private-prac- (accordingto Mom) and attemptingto MCG Hospital andClinics] obviously ticecommunity andtheentire staff," said findoutjusthow SantaClauscomes hadhergoals andheartset ontryingto Ms. Sodomka. down thechimney onChristmas Eve. provide a superbchildren's medicalcen- Kids are Ms. Ostric's favorite partof Inquisitiveminds, both athome andat terhere," said Ms. Ostric. "I hadalready thejob,butshealsodelights in nurturing work, keepMs. Ostric's life stimulating. metDr. [William P.] Kanto [CMC people intheircareers and watching them "Every kid's ahero," she said, "and Medical Director] whenhe spoke ata achieve theirpotential. "1 thinkone ofmy they'rejustwaiting fortheiropportunity conference several years agoin greatest strengths is understanding that toshowyou." 8 MEDICALCOLLEGEOFGEORGIATODAY