ebook img

Flt-3 Ligand PDF

14 Pages·2001·0.162 MB·English
Save to my drive
Quick download
Download
Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.

Preview Flt-3 Ligand

Flt-3 Ligand Bali Pulendran* and Stephanie Dillon Baylor Institute for Immunology Research, 3434 Live Oak, Dallas, TX 75204, USA *corresponding author tel: (908) 541-5146, fax: (908) 231-4988, e-mail: [email protected] DOI: 10.1006/rwcy.2001.0909. Chapter posted 5 November 2001 SUMMARY BACKGROUND Flt-3ligand(FL)isamemberofafamilyofcytokines Discovery that stimulate the proliferation of hematopoietic cells. Other cytokines in this family include stem TwoindependentgroupsclonedtheFLgenebyusing cell factor (SCF, also known as c-kit ligand, steel a soluble form of the Flt-3 receptor. Lyman et al. factor or mast cell growth factor) and colony- (1993a)screenedavarietyofcelllinesandidentifieda stimulating factor 1 (CSF-1, also known as macro- murine T cell line that specifically bound the Flt-3 phage colony-stimulating factor (M-CSF)). All three receptor. The ligand was the cloned from a cDNA of these cytokines belong to the ‘helical cytokine’ expression library made from these cells. Hannum family, whose members have (cid:11)-helical bundles in et al. (1994) used an affinity column made with the their structure. FL, SCF, and CSF-1 bind to type III mouse Flt-3 receptor extracellular domain to purify tyrosine kinase receptors (FL with Flt-3 receptor; FL from medium conditioned by a thymic stromal SCF with c-kit; and CSF-1 with c-fms), from the cell line. N-terminal sequencing of the purified platelet-derived growth factor receptor (PDGFR) protein generated a short amino acid sequence, subfamily of tyrosine kinase receptors (Lyman, 1998; which was then used to design degenerate oligo- Lyman and Jacobsen, 1998; Shurin et al., 1998; nucleotide primers to amplify a portion of the FL Antonysamy and Thomson, 1999). gene by PCR, subsequently leading to the cloning of FL is expressed ubiquitously, but expression of the full-length murine cDNA. Flt-3 receptor is restricted to progenitor cells of the hematopoietic system. FL is similar to SCF in that both proteins stimulate the proliferation of early Structure progenitor or stem cells. Neither of these factors has muchproliferativeactivityonitsown,buteachfactor FL is a type 1 transmembrane protein with a short can synergize with a wide range of other colony- cytoplasmic domain, with structural similarities to stimulating factors and interleukins to stimulate SCFandCSF-1(seeDescriptionofproteinsformore proliferation. A major difference between the two details). factors appears to be their effect on mast cells and erythroiddevelopment,whichSCFstimulatesbutFL does not. In addition, FL has the unique ability to Main activities and stimulate the generation of multiple dendritic cell pathophysiological roles (DC) subsets, in vivo, in mice and in humans. As a result, FL has considerable clinical potential in the areas of stem cell regeneration and mobilization, and FL is a growth factor for hematopoietic progenitors in the immunotherapy of cancer and infectious in vitro and induces hematopoietic progenitor and diseases (Lyman, 1998; Lyman and Jacobsen, 1998; stem cell mobilization in vivo. FL alone can weakly Shurin et al., 1998; Antonysamy and Thomson, stimulate the proliferation of mouse and human 1999). hematopoietic progenitors, or can syngergize with a CytokineReference Copyright#2001AcademicPress 2 Bali Pulendran and Stephanie Dillon number of cytokines to exert more potent effects. In PROTEIN addition, when mice are injected with FL, there is a dramatic expansion of multiple DC subsets. Accession numbers Immature B cells, natural killer (NK) cells, and monocytes are also expanded, to a lesser extent, Mus musculus: FMS-like tyrosine kinase 3 ligand: invivo.Similarly,injectionsofFLintohumanscauses NP_038548 a dramatic expansion of DCs in the blood (Lyman, Homo sapiens: fms-related tyrosine kinase 3 ligand: 1998; Lyman and Jacobsen, 1998; Shurin et al., 1998; NP_001450 Antonysamy and Thomson, 1999). Human: Flt3 ligand alternatively spliced isoform: I39076 Felis catus: Flt3 ligand: AAF87089 GENE AND GENE REGULATION Canis familiaris: Flt3 ligand: AAF87088 Accession numbers Sequence Mus musculus FMS-like tyrosine kinase 3 ligand See Figure 1. (Flt3L) mRNA: NM_013520 Homo sapiens fms-related tyrosine kinase 3 ligand (FLT3LG) mRNA: NM_001459 Description of protein Bos taurus flt3 ligand isoform-2 mRNA, complete cds: AF282986 FL is a noncovalently linked homodimer, and is Bos taurus flt3 ligand isoform-1 mRNA, complete biologicallyactivebothasatransmembraneformand cds: AF282985 as a soluble form that is generated by proteolytic Felis catus Flt3 ligand mRNA, complete cds: cleavage of the extracellular domains of the trans- AF155149 membrane protein (reviewed by Lyman and Canis familiaris Flt3 ligand mRNA, complete cds: Jacobsen, 1998). The relative importance of the two AF155148 formsisunclear.Thepredominantisoforminhumans is the transmembrane protein, which can be proteolytically cleaved to generate a soluble FL Chromosomal location molecule (Lymanet al., 1993a, 1994, 1995a; Hannum et al., 1994; McClanahan et al., 1996). In mice, the Mouse FL gene: proximal portion of mouse predominantisoformisa220aminoacidformthatis chromosome 7. membrane bound, but not transmembrane (Hannum Human FL gene: chromosome 19q13.3. et al., 1994; Lyman et al., 1995a; McClanahan et al., 1996). This form arises due to a failure to splice an intron from the mRNA. Other isoforms of both Relevant linkages human and murine FL have been identified, but their biological significance is unknown (Lyman Nogeneticdiseaseshavebeenassociatedwiththeloci et al., 1993a, 1994, 1995a; Hannum et al., 1994; for FL (Lyman and Jacobsen, 1998). McClanahan et al., 1996). Figure 1 Amino acid sequence for human and mouse Flt-3 ligand. Human 1 mtvlapawspttylllllllssglsgtqdcsfqhspissdfavkirelsdyllqdypvtv 61 asnlqdeelcgalwrlvlaqrwmerlktvagskmqgllervnteihfvtkcafqpppscl 121rfvqtnisrllqetseqlva lkpwitrqnfsrclelqcqpdsstlpppwsprpleatapt 181apqpplllllllpvglllla aawclhwqrtrrrtprpgeqvppvpspqdlllveh Mouse 1mtvlapawspnssllllllllspclrgtpd cyfshspissnfkvkfreltdhllkdypvt 61 vavnlqdekhckalwslflaqrwieqlktvagskmqtlledvnteihfvtsctfqplpec 121lrfvqtnishllkdtctqll alkpcigkacqnfsrclevqcqpdsstllpprspialeat 181elpeprprqlllllllllpl tlvllaaawglrwqrarrrgelhpgvplpshp Flt-3 Ligand 3 The type 1 transmembrane protein consists of a IN VITRO ACTIVITIES short cytoplasmic domain, with structural similarities to SCF and CSF-1. The genomic loci of the coding In vitro findings regions of mouse and human FL are approximately 4.0kb and 5.9kb, respectively. The coding region A number of studies have investigated the effect of comprises eight exons (reviewed in Lyman and FL on the expansion of hematopoietic cells in vitro. Jacobsen, 1998). The mouse and human proteins FL alone weakly stimulates the growth of hemato- contain 231 and 235 amino acids, respectively. The poieticstemandprogenitorcellsaswellaslineagesin first27(mouse)or26(human)aminoacidsconstitute the lymphoid and myeloid pathways, but has a much a signal peptide that is absent from the more potent effect when used in combination with mature protein, followed by a 161 (mouse) or 156 other growth factors (Table 1; Lyman, 1998; Lyman (human) amino acid extracellular domain, a 22 and Jacobsen, 1998; Shurin et al., 1998; Antonysamy (mouse) or 23 (human) amino acid transmembrane and Thomson, 1999). For example, FL induces the domain, and a 21 (mouse) or 30 (human) amino growth of colony-forming cells and progenitors acid cytoplasmic tail. The mouse and human FL from murine bone marrow cells when used in proteins each contain two potential sites for combination with IL-3, IL-6, IL-11, IL-12, granulo- glycosylation. cyte–macrophage colony-stimulating factor (GM- CSF), granulocyte colony-stimulating factor Discussion of crystal structure (G-CSF), thrombopoietin (TPO), CSF-1, or SCF (Hudak et al., 1995; Jacobsen et al., 1995; Ramsfjell et al., 1996). The strongest synergy was observed The crystal structure of FL reveals that it is a when FL was used in combination with the ligands homodimer of two short-chain (cid:11)-helical bundles that did not signal through the tyrosine kinase (Savvides et al., 2000). Comparisons with the receptor. FL is a weak proliferative stimulus for homologous cytokines SCF and CSF-1 suggest that Sca-1(cid:135)Linlo cells isolated from mouse fetal liver, but they have a common receptor-binding mode that is synergizes with IL-7 or SCF to promote growth distinctfromthecomplexofgrowthhormonewithits (Lyman et al., 1993b). receptor. Furthermore, there are recognition features FL has a weak proliferative capacity on human common to all helical and cystine-knot protein bonemarrow,cordblood,andperipheralbloodcells, ligands that activate type III tyrosine kinase butsynergizeswithothergrowthfactorssuchasGM- receptors, and the closely related type V tyrosine CSF, IL-3, SCF, IL-6, G-CSF, IL-1(cid:12), TPO and kinase receptors (Savvides et al., 2000). erythropoietin (EPO) to induce the ex vivo expansion and colony growth of human hematopoietic cells (Lyman et al., 1994; Broxmeyer et al., 1995; CELLULAR SOURCES AND Gabbianelli et al., 1995; McKenna et al., 1995; TISSUE EXPRESSION Brashem-Stein et al., 1996; Koller et al., 1996; Shapiro et al., 1996; Piacibello et al., 1998). Human Cellular sources that produce Flt-3 cordbloodcellsexpandedfor12weeksinculturewith FL, SCF, TPO, and IL-6 have been successfully ligand engrafted into sublethally irradiated nonobese dia- betic severe combined immunodeficient mice and the FL is ubiquitously expressed in different tissues in addition of IL-3 greatly reduced the repopulating bothmiceandhumans;highestexpressionisfoundin potential of these cultures (Piacibello et al., 1999, humanperipheralbloodmononuclearcells(PBMCs), 2000). It has been postulated that the increased but expression is also found in most other tissues recruitment of CD34(cid:135)CD38(cid:255) cells into the cell cycle examined (Rosnet et al., 1991; Matthews et al., 1991; is the basis for the ex vivo expansion potential of Brasel et al., 1995; DeLapeyriere et al., 1995). In FL(Haylocketal.,1997).FLactssynergisticallywith contrast,Flt-3receptorexpressionislargelyrestricted G-CSF to enhance expansion of colony growth from to the progenitor/stem cell compartment. human fetal liver (Muench et al., 1997). FL acts in synergy with various combinations of othergrowthfactorsandcytokinesintheearlystages RECEPTOR UTILIZATION of thymopoiesis (Freedman et al., 1996; Moore and Zlotnik, 1997), NK cell development (Miller et al., FL utilizes Flt-3 receptor. 1998) and B cell development (Hirayama et al., 1995; 4 Bali Pulendran and Stephanie Dillon Table1 Flt-3ligandactsinsynergywithothergrowthfactorstoinducetheexpansionofvarioushematopoieticprogenitor cell populations Starting population Combination of growth factors Reference Expansion and colony formation of human stem/progenitor cells CD34(cid:135) BM and CB FL (cid:135) PIXY321, IL-3, or GM-CSF Lyman et al., 1994 Primitive progenitors FL (cid:135) SCF, IL-3, IL-6 or GM-CSF Hannum et al., 1994 CD34(cid:135) BM FL (cid:135) PIXY321; FL (cid:135) EPO (cid:135) PIXY321; McKenna et al., 1995 FL (cid:135) IL-1(cid:11) (cid:135) IL-3 (cid:135) IL-6 (cid:135) EPO CD34(cid:135) Lin(cid:255) CD38(cid:255) FL (cid:135) IL-3, IL-6, G-CSF, GM-CSF or Brashem-Stein et al., 1996 SCF; FL (cid:135) IL-3 (cid:135) SCF CD34(cid:135) BM and CB FL (cid:135) GM-CSF, G-CSF, CSF-1; Broxmeyer et al., 1995 FL (cid:135) IL-3 (cid:6) SCF, FL (cid:135) EPO (cid:135) SCF CD34(cid:135) BM and PB FL (cid:135) IL-3, GM-CSF, TPO Gabbianelli et al., 1995 BM and PB FL (cid:135) GM-CSF, IL-3 Koller et al., 1996 CD34(cid:135) CD38(cid:255) BM FL (cid:135) IL-3, SCF Petzer et al., 1996 CD34(cid:135) CD38(cid:255) BM FL (cid:135) IL-3, IL-6, SCF Shah et al., 1996 CD34(cid:135) CB FL (cid:135) TPO Piacibello et al., 1998 CD34(cid:135)(cid:135) fetal liver FL (cid:135) IL-3, GM-CSF, SCF Muench et al., 1995 CD34(cid:135) BM, CB, PB, fetal liver FL (cid:135) IL-3 (cid:135) IL-6 (cid:135) G-CSF Shapiro et al., 1996 Generation of human T cells using irradiated thymic stromal layers CD34(cid:135) BM FL (cid:135) IL-12 Freedman et al., 1996 Proliferation of human CD34(cid:135) CD19(cid:135) pro-B cells Fetal BM FL (cid:135) IL-7 Namikawa et al., 1996 Frequency of human NK cell progenitors using stroma noncontact culture CD34(cid:135) Lin(cid:255) DR(cid:255) BM FL (cid:135) IL-2 (cid:135) IL-7 (cid:135) SCF (cid:135) stromal factors Miller et al., 1998 Expansion of human megakaryocyte colony-forming units CD34(cid:135) PB stem cells FL (cid:135) IL-3, IL-6, IL-11, SCF, TPO, MIP-1(cid:11) Halle et al., 2000 CD34(cid:135) CB FL (cid:135) TPO Li et al., 2000 Expansion and colony formation of murine stem/progenitor cells Lin(cid:255) Ly-6A/E(cid:135) BM FL (cid:135) IL-6, IL-11, G-CSF Hirayama et al., 1995 Thylo Sca-1(cid:135) Lin(cid:255) BM FL (cid:135) IL-3, IL-6, SCF, GM-CSF, G-CSF, IL-10 Hudak et al., 1995 Lin(cid:255) Sca-1(cid:135) BM FL (cid:135) IL-11, IL-12, G-CSF, IL-3, IL-6, SCF Jacobsen et al., 1996 Lin(cid:255) Sca-1(cid:135) BM FL (cid:135) TPO; FL (cid:135) SCF (cid:135) TPO; Ramsfjell et al., 1996 FL (cid:135) IL-11 (cid:135) TPO; FL (cid:135) IL-12 (cid:135) TPO Maintenance of murine progenitor and stem cells with reconstituting ability Lin(cid:255) Sca-1(cid:135) c-kit(cid:135) BM FL (cid:135) IL-11 Yonemura et al., 1997 Proliferation and differentiation of murine T cells Thymic CD4lo cells IL-3 (cid:135) IL-6 (cid:135) IL-7 Moore and Zlotnik, 1997 Proliferation of murine B cells Lin(cid:255) Ly-6A/E(cid:135) BM FL (cid:135) SF (cid:135) IL-7 Hirayama et al., 1995 BM,bonemarrow;CB,cordblood;PB,peripheralblood;PIXY-321,GM-CSF/IL-3fusionprotein. Flt-3 Ligand 5 Namikawa et al., 1996; Jayne et al., 1999). FL, again The potential of FL to expand acting in synergy with other growth factors, can various cell populations in vitro increase the expansion of megakaryocyte progenitors in human cord blood (Li et al., 2000) and peripheral blood stem cells (Halle et al., 2000). The ability of FL to expand hematopoietic cell Transforming growth factor (cid:12) (TGF(cid:12)) and tumor populationshasbeenutilizedinanumberofdifferent necrosis factor (cid:11) (TNF(cid:11)) inhibit the growth of in vitro culture systems to provide increased numbers murineandhumanhematopoieticcellsinducedbyFL of cells, particularly DCs, for either further analysis (Jacobsen et al., 1996; Ohishi et al., 1996; Ramsfjell or for further manipulation (Table 2). et al., 1997). FL does not appear to have any effects on murine Bioassays used (Hudak et al., 1995; Jacobsen et al., 1995) or human (Hannumetal.,1994;McKennaetal.,1995)erythroid developmentinvitro.Similarly,FLdoesnothaveany The quantification of FL has been performed on a effectonmastcelloreosinophildevelopment(Lyman Ba/F3 cell line expressing murine Flt-3/flk-2 receptor etal.,1995b;Hudaketal.,1995;Hjertsonetal.,1996). (Hannum et al., 1994). Additionally, the WWF7, This is in contrast to SCF which does have potent a murine Pro-B cell line, is used as a bioassay for effectonthesetwolineages(Costaetal.,1996). FL (Brasel et al., 1995). Table 2 Flt-3 ligand can be used as a growth factor to expand cell populations, particularly DCs, in vitro Cell type In vitro treatment Result Reference Human PB CD34(cid:135) cells FL, GM-CSF, TNF(cid:11), More efficient than SCF to Guardiola et al., 1997 SCF, IL-4 generate functional CD1a(cid:135) DCs Human PBMCs FL, IL-4; maturation by Generation of DCs Brossart et al., 1998 TNF(cid:11) or CD40L Human CB cells FL, TNF(cid:11), GM-CSF, SCF Generation CD1a(cid:135) CD14(cid:255) Canque et al., 1998 and CD1a(cid:255) CD14(cid:135) DCs Human BM CD34(cid:135) cells FL, GM-CSF, IL-4, TNF(cid:11), Increase in numbers of Maraskovsky et al., 1996 (cid:6) SCF functionally mature DCs Human BM CD34(cid:135) cells FL, G-CSF, EPO, MGDF, Preferential expansion of Kobari et al., 1998 IL-6, IL-3, SCF precursor cells, CD34(cid:135) cells, CFU-GM, BFU-E, LTC-IC Human BM CD34(cid:135) cells FL, GM-CSF, TNF(cid:11), Maximum expansion and Soligo et al., 1998 TGF(cid:12), SCF purity of DCs Human BM CD34(cid:135) cells FL, SCF, TNF(cid:11), TGF(cid:12)1, FL further enhanced Strobl et al., 1998 GM-CSF LC development Murine BM and spleen GM-CSF, IL-4 Large numbers of Shurin et al., 1997 (prior in vivo administration functionally mature DCs of FL) Murine BM FL; activation induced by Generation of functional Brasel et al., 2000 LPS or IFN(cid:11) CD8(cid:11)(cid:135) and CD8(cid:11)(cid:255) DCs Murine livers (prior in vivo GM-CSF, IL-4 Large numbers of functional DCs Drakes et al., 1997 administration of FL) Bovine BM FL, GM-CSF, IL-4 Generation of functional DCs Hope et al., 2000 exclusively of the myeloid origin Baboon BM (prior in vivo FL and other hematopoietic Increase in gene transfer Kiem et al., 1998 administration of G-CSF growth factors into hematopoietic cells and SCF) PB,peripheralblood;PBMC,peripheralbloodmononuclearcells;CB,cordblood;BM,bonemarrow;LC,Langerhanscells; MGDF,megakaryocytegrowthanddevelopmentfactor;CFU-GM,colony-formingunit–granulocytemacrophage; BFU-E,burst-forminguniterythroid;LTC-IC,long-termculture-initiatingcell. 6 Bali Pulendran and Stephanie Dillon IN VIVO BIOLOGICAL DC numbers plateauing with continued injection. Following cessation of treatment however, there is a ACTIVITIES OF LIGANDS IN dramaticdeclineinthenumbersofDCs,withbaseline ANIMAL MODELS levels being reached within a week. Phenotypically and functionally, and in their microenvironmental Normal physiological roles localization, FL-generated DCs appear identical to the corresponding DC subsets in normal mice The in vivo effects of FL have been thoroughly (Maraskovsky et al., 1996; Pulendran et al., 1997; investigated with many reflecting the observations Shurin et al., 1997). When freshly isolated they made in vitro (Table 3). Chinese hamster ovary possessnumerousdendrites,afeatureofmatureDCs. (CHO)-expressedFL(ratherthanyeast-derivedFLor They express significant levels of CD86, and E.coli-derived FL) has profound hematopoietic efficiently stimulate CD4 and CD8 T cells in vitro effects when injected into mice for 2 weeks (Brasel and in vivo. FL-generated myeloid and lymphoid- etal.,1996).Thereisalargeincreaseintheperipheral related DCs induce TH2 and TH1 responses, blood leukocyte count comprising of an approximate respectively, in vivo (Pulendran et al., 1999) in a 3-fold increase in lymphocytes, a 10-fold increase in similar fashion to responses observed with these DC granulocytes, and a 78-fold increase in monocytes. subsets from normal mice (Maldanado et al., 1999). Leukocyte counts also rise in bone marrow and This ability to differentially modulate T helper spleen. In addition, a profound increase of hemato- responses may, in part, be explained by differences poieticprogenitorcellsinthespleen(100-fold),blood in their ability to secrete IL-12 (Maldanado et al., (200- to 500-fold) and bone marrow (5-fold) occurs. 1999; Pulendran et al., 1999). Recently, the intrave- FL administration has no apparent effect on mast nous injection into mice of naked DNA that encoded cell proliferation or activation. FL synergistically secreted human FL dramatically increased the enhances the G-CSF-induced in vivo expansion of number of both DCs and NK cells (He et al., 2000). peripheral blood progenitors in mouse blood, Mature DCs do not express Flt-3 receptor and do increasing the levels of monocytes and basophils not proliferate when cultured in FL alone. Thus the and mobilizing blood stem cells with long-term potent effects of FL on DC development are most repopulating potential (Sudo et al., 1997; Molineux likely due to its ability to induce the expansion and etal.,1997;Ashiharaetal.,1998).Similarresultswere differentiation of DC precursors or progenitors. found when FL was injected into primates Indeed, in addition to elevated numbers of mature (Papayannopoulou et al., 1997). Furthermore, in DCs, FL injections also increase the numbers of mice, the numbers and functional activity of CD3(cid:255) precursor and immature DCs, which express much NK1.1(cid:135) NK cells is increased in bone marrow, lower levels of MHC class II, CD11c, and costimu- thymus, blood, spleen, and liver (Shaw et al., 1998). latory molecules (Maraskovsky et al., 1996; In contrast, an increase in numbers of CD3(cid:135) Pulendran et al., 1997). NK1.1(cid:135) T cells occurred mainly in the spleen. Perhaps the most striking, and clinically relevant Species differences effect of FL injections is the dramatic increase in DC numbers (Table 3; discussed below). TheeffectsofFLinvitroarenotspecies-specific,with recombinant human FL and recombinant murine FL activeonhumancordbloodandbonemarrowandon Effects on DC development mouse bone marrow (Lyman et al., 1994; Broxmeyer et al., 1995). Additionally, recombinant human FL Daily FL injections into mice causes a dramatic hasbeenusedtoexpandhematopoieticcellsandDCs increase in the numbers of mature myeloid (CD11c(cid:135) invivointhemouse(Braseletal.,1996;Maraskovsky CD11b(cid:135) CD8(cid:11)(cid:255) MHC class II(cid:135)) and putative et al., 1996). In fact, human FL can stimulate mouse, lymphoid-related (CD11c(cid:135) CD11b(cid:255) CD8(cid:11)(cid:135) MHC cat, rabbit, nonhuman primate, and human cells class II(cid:135)) DC subsets in various lymphoid and non- (Lyman and Jacobsen, 1998). lymphoid tissues such as the spleen, lymph nodes, Peyer’s patch, thymus, bone marrow, blood, lungs, Knockout mouse phenotype liver, gut-associated lymphoid tissues, and the peritoneal cavity (Maraskovsky et al., 1996; Pulendran et al., 1997). Maximal numbers of DCs In mice lacking FL (FL(cid:255)/(cid:255) mice, generated by are obtained when FL is injected for 9–11 days, with targeted gene disruption), leukocyte cellularity was Flt-3 Ligand 7 Table 3 In vivo activities of Flt-3 ligand Description of FL Administration Effect Reference CHO cell-hFL Daily injections into mice, Expansion of CFU in BM and Brasel et al., 1996 i.p. or s.c., 15 days mobilization of hematopoietic progenitors/stem cells into PB and spleen CHO cell-hFL Daily injections into mice, Increase in DC number in Maraskovsky et al., 1996 s.c., 9 days multiple tissues; identified two major DC subsets CHO cell-hFL Daily injections into mice, Detailed analysis of DC Pulendran et al., 1997 s.c., 9 days populations expanded by FL CHO cell-hFL Daily injections into mice, Time-dependent, reversible Shurin et al., 1997 s.c., up to 10 days accumulation of DCs in spleen, BM, lymph nodes and liver and extramedullary hematopoiesis CHO cell-hFL Daily injections into mice, Increase in nonparenchymal cells Drakes et al., 1997 i.p., 10 days in liver. Propagation of DCs when cultured with GM-CSF and IL-4 CHO cell-hFL Daily injections into mice, Synergistic effect of mobilization Sudo et al., 1997 and rmGM-CSF s.c., 3–9 days of hematopoietic stem and progenitor cells E. coli expressed rhFL Continuous s.c infusion Synergistic effect to increase Molineux et al., 1997 and rhG-CSF into mice monocytes and basophils in blood and to mobilize cells that facilitate long-term hematopoietic engraftment Yeast- or CHO Daily injections into primates, Synergistic effect in mobilization Papayannopoulou cell-hFL and s.c, 7–12 days of progenitors into blood et al., 1997 rhG-CSF CHO cell-hFL Daily injections into mice, Enhancement of B and T cell Pulendran et al., 1998 s.c., 9 days responses in vivo to soluble protein and prevention of establishment of peripheral tolerance CHO cell-hFL Daily injections into mice, Increase in number of functional Shaw et al., 1998 i.p, up to 18 days NK cells in multiple tissues FL Daily injections into mice, Mobilization of primitive and Ashihara et al., 1998 s.c, 5–6 days committed progenitors into PB, dose-dependent CHO cell-hFL Daily injections into mice, Expansion of DC subsets with Pulendran et al., 1999 s.c., 9 days functional differences DNA encoding Single injection into mice, i.v. Expansion of functional DCs He et al., 2000 human FL (hFlex) and NK cells CHO cell-hFL Daily injections into humans, Phase 1 clinical study; Expansions Maraskovsky s.c., 14 days of DC precursors and subsets et al., 2000 CHO cell-hFL Daily injections into humans, FL mobilized CD11c(cid:135) DCs and Pulendran et al., 2000 or G-CSF s.c., 10 days (FL) or 5 days CD11c(cid:255) DCs into blood; G-CSF (G-CSF) only increased levels of CD11c(cid:255) DC subset. CHOcell-hFL,Chinesehamsterovarycell-derivedhumanFL;rm,recombinantmurine;rh,recombinanthuman;CFU,colony-formingunit; BM,bonemarrow;PB,peripheralblood. 8 Bali Pulendran and Stephanie Dillon reducedinthebonemarrow,peripheralblood,lymph PATHOPHYSIOLOGICAL ROLES nodes, and spleen (McKenna et al., 2000). Thymic IN NORMAL HUMANS AND cellularity, blood hematocrit, and platelet numbers DISEASE STATES AND were not affected. Significantly reduced numbers of myeloid and B lymphoid progenitors were noted in DIAGNOSTIC UTILITY the bone marrow of FL(cid:255)/(cid:255) mice. In addition a marked deficiency of NK cells in the spleen was Normal levels and effects noted. DC numbers were also reduced in the spleen, lymph node, and thymus. Both myeloid-related In normal individuals, serum levels of FL are (CD11c(cid:135) CD11b(cid:135) CD8(cid:11)(cid:255) MHC class II(cid:135)) and relatively low (<100pg/mL) when compared with lymphoid-related (CD11c(cid:135) CD11b(cid:255) CD8(cid:11)(cid:135) MHC levels of other structurally homologous growth class II(cid:135)) DC numbers were reduced (McKenna factors, SCF and CSF-1, which are present at levels et al., 2000). This confirms that FL has an important ranging from 2 to 6ng/mL, and 2 to 4ng/mL, role in the expansion of early hematopoietic respectively (Lyman et al., 1995; Hjertson et al., progenitors and in the generation of mature 1996). peripheral leukocytes. Mice lacking the Flt-3 receptor exhibit a number of hematological defects but the phenotype is Role in experiments of nature and not as profound as for the FL knockout disease states mice (Mackarehtschian et al., 1995; McKenna et al., 2000). Enhanced levels of FL (<10ng/mL) have been noted in certain stem cell or progenitor cell disorders such as Fanconi anemia and acquired aplastic anemia Transgenic overexpression (Lyman et al., 1995b). Cancer patients treated with chemotherapy and/or radiation also have high levels The effect of chronic expression of FL on in vivo of serum FL (Wodnar-Filipowicz et al., 1996). It hematopoiesis was studied by retroviral vector- has been postulated that the augmentation in FL in mediated gene transfer in a mouse model of bone these situations is the result of a physiological marrow transplantation to enforce expression of homeostatic response to increase the level of FL mouse FL cDNA in hematopoietic tissues (Juan to stimulate the proliferation of the remaining stem et al., 1997). Peripheral blood white blood cell cells (Lyman et al., 1995b). A priori, the levels of FL counts in FL-overexpressing recipients were signifi- are not elevated in disease states that affect the cantly elevated compared with controls. With the erythroid lineage (e.g. (cid:11) thalassemia or red cell exception of eosinophils, all nucleated cell lineages aplasia). Normal levels of FL result in an individual studied were similarly affected in these animals. when hematological disorders are treated with Experimental animals also exhibited severe anemia immunosuppressive therapy, blood transfusions or a and progressive loss of marrow-derived erythropoi- bone marrow transplant (Lyman et al., 1995b; esis. All of the FL-overexpressing animals, but none Wodnar-Filipowicz et al., 1996). of the controls, died between 10 and 13 weeks posttransplantation. Upon histological examination, severe splenomegaly was noted, with progressive IN THERAPY fibrosis and infiltration by abnormal lymphoreticular cells. Abnormal cell infiltration also occurred in The potent effects of FL on hematopoiesis and DC other organ systems, including bone marrow and development have prompted much interest in its liver. In situ immunocytochemistry on liver sections therapeuticpotential.Aplethoraofpreclinicalstudies showed that the cellular infiltrate was CD3(cid:135)/ have suggested numerous applications for FL which NLDC145(cid:135)/CD11c(cid:135), but B220(cid:255) and F4/80(cid:255), are considered below. suggestive of a mixed infiltrate of DCs and activated T lymphocytes. Infiltration of splenic blood vessel DC-based Immunotherapies perivascular spaces resulted in vascular compression and eventual occlusion, leading to splenic necrosis DCs, by virtue of their unique ability to capture, consistent with infarction (Juan et al., 1997). These process, and present antigens, and their potent results confirm that FL can affect both myeloid and immunoregulatory potentials, have been described lymphoid cell lineages in vivo. as ‘Nature’s adjuvants’ (Steinman, 1991). However, Flt-3 Ligand 9 their exploitation for clinical use has been ham- recently shown to augment the immune response pered by their rarity. As such, FL has prompted to an HIV peptide vaccine in mice (Pisarev et al., much interest as a potential agent for tumor 2000). The HGP-30 peptide used in these studies is a therapy or a vaccine adjuvant in infectious disease synthetic peptide that corresponds to a highly settings. conserved region of HIV-1 p17 gag. Mice were FL injections have been observed to have immunized with HGP-30 or HGP-30 conjugated to antitumoractivitiesinmousemodelsoffibrosarcoma keyhole limpet hemocyanin and delayed-type hyper- (Lynchetal.,1997),breastcancer(Chenetal.,1997), sensitivity responses, antibody (IgG) amount and leukemia (Pawlowska et al., 1998), ovarian cancer antigen-specific proliferative responses by spleen cells (Silver et al., 2000) and, when combined with IL-12, were used to monitor the immune response. C3 sarcoma liver metastases (Pe´ron et al., 1998). The Daily injections of FL prior to HGP-30 administra- effect appears to be mediated, in part, by CD8(cid:135) tion enhanced significantly the antigen-specific Tcells(presumablycytotoxicTcells),becausetumor- lymphocyte proliferation response when compared rejecting activity can be transferred by spleen cells, with FL, HGP-30 alone, or HGP-30 containing but not by CD8(cid:135) or Thy1(cid:135) depleted spleen cells liposomes. (Lynch et al., 1997). NK cells also contribute since In humans, FL causes a dramatic increase in the depletion of these cells leads to a greatly decreased numbers of immature DCs in the peripheral blood antitumor effect by FL on C3 sarcoma liver (Maraskovsky et al., 2000; Pulendran et al., 2000). metastases (Pe´ron et al., 1998) and an absence of an Experiments are now underway to assess whether FL-mediated delay in the growth of ovarian tumors healthy volunteers injected with FL exhibit increases engrafted in SCID mice (Silver et al., 2000). CD40L in B and T cell responses towards a cocktail of and FL act synergistically to promote the prolifera- antigens such as KLH, tetanus toxoid, and the tion and survival of DCs and increase antitumor hepatitis and influenza vaccines. immunity against B10.2 and 87 sarcomas (Borges In addition to FL acting as a potent immune et al., 1999). Favre-Felix et al. (2000) recently adjuvant, studies have shown that the expansion of showed that FL lessens the growth of tumors DCs by FL can augment the induction of oral obtained after a colon cancer cell line was tolerance (Viney et al., 1998). In contrast, a injected into rats, but it did not restore tumor- combinationofFLandIL-1(cid:11)inducesapotentactive suppressed DC function. In addition, injection of response to fed soluble antigen rather than the B16 melanoma cells expressing FL resulted in the tolerogenic response noted with FL alone dramatic increase of CD11c(cid:135) cells in the spleen (Williamson et al., 1999). The contrasting effects on and tumor infiltrate (Mach et al., 2000). Results T cell tolerance to orally versus systemically from these studies suggest that FL can potentially administered antigens may reflect functional differ- be used in the treatment of human cancer patients. ences in DC subsets or differences in microenviron- DCs generated by FL in mice can efficiently ments (Pulendran et al., 1998). stimulate antigen-specific CD4(cid:135) and CD8(cid:135) T cells It is possible that the tolerance-inducing in vitro and in vivo (Maraskovsky et al., 1996; capacity of FL could be utilized in transplanta- Pulendran et al., 1998; Daro et al., 2000). FL tion. Donor microchimerism, the long-term persis- administration to mice dramatically enhances anti- tence of donor hematopoietic cells in transplant gen-specific B and T cell responses against recipients, has been postulated to be a vital soluble antigens, injected subcutaneously or intra- prerequisite for the induction of immune tolerance peritoneally, without any other adjuvants to transplanted organs (Starzl et al., 1996). The use (Pulendran et al., 1998). Interestingly, FL injection of FL to augment natural microchimerism is now is also able to abrogate the peripheral tolerance being investigated as a new immunotherapeutic induced by systemic injections of soluble antigens approach to allograft rejection. FL can increase (Pulendran et al., 1998). Injection of FL also microchimerism in allogenic bone marrow and heart markedly enhances the magnitude of polyomavirus- transplant recipients in the presence of immunosup- specific CD8(cid:135) T cell responses during acute pression (Antonysamy et al., 1998; for a detailed infection and the pool of memory anti-polyomavirus review see Antonysamy and Thomson, 1999). On a CD8(cid:135) T cells (Drake et al., 2000). These findings cautionary note, there was an increase in the suggest that virus-infected DCs induce polyoma antidonor response and reduced graft survival virus-specific CD8(cid:135) T cells in vivo and raise the when the immunosuppressive drug was withdrawn, potential for the use of FL as a vaccine adjuvant to highlighting the risks of creating an immunological promote CD8(cid:135) T cell immunity against viral imbalance between donor and host cells following infections (Drake et al., 2000). In addition, FL was the use of growth factors. 10 Bali Pulendran and Stephanie Dillon Mobilization of Stem Cells expanded ex vivo with FL. Hematopoietic reconstitu- tion following high-dose chemotherapy was observed InjectionofFLfor10–14daysintomice,primates,and when small volumes of bone marrow aspirates from humans produces a large increase in the number of patients with breast cancer were expanded ex vivo colony-formingcells inperipheralblood(reviewedby with EPO, PIXY 321 (GM-CSF/IL-3 fusion protein) Lyman and Jacobsen, 1998). Stem cells mobilized by and FL (Bachier et al., 1999; Stiff et al., 2000). FL results in long-term multilineage hematopoietic Trials have begun using FL to expand human DC reconstitutioninmice(Braseletal.,1996).Asobserved populations in vivo. In a phase I clinical study, FL invitro,FLalsosynergizeswitheitherGM-CSForG- was administered to healthy human volunteers CSF to mobilize colony-forming cells into peripheral resulting in an expansion of circulating CD11c(cid:135) blood in mice (Molineux et al., 1997; Brasel et al., and CD11c(cid:255) DC subsets and precursors 1996) and primates (Papayannopoulou et al., 1997). (Maraskovsky et al., 2000). Both FL and G-CSF ThesepropertiesmakeFLanattractivecandidatefor enhance DC subset numbers in the peripheral blood the treatment of patients who are hematopoietically of healthy human volunteers, with FL expanding compromised(fordetailedreviewsseeEmerson,1996; both the precursor DC (CD11c(cid:255)) subset and the LymanandJacobsen,1998). immature DC (CD11c(cid:135)) subset, whereas G-CSF expands only the precursor subset (Pulendran et al., Gene Therapy 2000). Studies are now underway to determine if FL and G-CSF elicit distinct types of immune responses Theabilityofhematopoieticstemcellstoselfrenewand in healthy individuals and thereby provide a novel produce large numbers of progeny makes them ideal strategyforthemanipulationofimmuneresponsesin targets for gene therapy. FL can be used to stimulate humans. The number of DCs mobilized into the stem cell proliferation, thereby providing the actively peripheral blood of patients with colon cancer dividing cells that are necessary for retroviral metastatic to the liver or lung increased following transduction. The combination of FL and IL-3 was in vivo administration of FL, an observation that most potent in promoting the transduction effi- may be associated with increases in DC numbers at ciency of a retrovirus into human hematopoietic cells the periphery of the tumors (Morse et al., 2000). (Elwood et al., 1996). The potential to target gene therapytoDCsthathavebeenexpandedbyFLisalso appealing(AntonysamyandThomson,1999). ACKNOWLEDGEMENTS Radioprotective Effects We thank Dr Hilary McKenna (Immunex) for her Support for the radioprotective clinical potential of expert advice during the preparation of this manu- FL has been demonstrated in vivo where FL alone script. Supported by grants from Baylor Health Care or in combination with G-CSF protected rabbits Foundation and NIH (DK57665-01, AI48638-01 and against the effects of total body irradiation on the 1R21AI/DE48154-01) to BP. stem cell compartment (Gratwohl et al., 1998). FL in combination with SCF, TPO, and IL-3 reduces References radiation-induced apoptosis in CD34(cid:135) progenitor cells in vitro, further suggesting a potential thera- peutic role in preserving functional hematopoietic Antonysamy, M. A., and Thomson, A. W. (1999). FLT3 progenitor and stem cells from in vivo radiation ligand (FL) and its influence on immune reactivity. Cytokine damage (Drouet et al., 1999). 12,87–100. Antonysamy,M.A.,Steptoe,R.J., Khanna,A.,Rudert, W.A., Subbotin, V. M., and Thomson, A. W. (1998). Flt-3 ligand increasesmicrochimerismbutcanpreventthetherapeuticeffect Toxicity of donor bone marrow in transiently immunosuppressed car- FL administration to healthy human volunteers diacallograftrecipients.J.Immunol.160,4106–4113. Ashihara, E., Shimazaki, C., Sudo, Y., Kikuta, T., Hirai, H., appears to be safe (Maraskovsky et al., 2000; Sumikuma, T., Yamagata, N., Goto, H., Inaba, T., Fujita, Pulendran et al., 2000). N., and Nakagawa, M. (1998). FLT-3 ligand mobilizes hema- topoieticprimitiveandcommittedprogenitorcellsintobloodin mice.Eur.J.Haematol.60,86–92. Clinical Results Bachier, C. R., Gokmen, E., Teale, J., Lanzkron, S., Childs, D., Franklin, W., Shpall, E., Douville, J., Weber, S., Muller, T., Clinical trials are now underway to determine the Armstrong, D., and Le Maistre, C. F. (1999). Ex-vivo expan- safety and efficacy of transplanting cell populations sionofbonemarrowprogenitorcellsforhematopoieticrecon-

See more

The list of books you might like

Most books are stored in the elastic cloud where traffic is expensive. For this reason, we have a limit on daily download.